k--by nameby namesarumand kS$"++߯-"./copyright-------------------- IBM AIX PS/2 Operating System Extensions Version 1.3.0 Administrative Support 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Operating System Extensions Version 1.3.0 Extended Programming Support 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Operating System Extensions Version 1.3.0 Manual Pages 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Application Development Toolkit Version 1.3.0 Advanced Development Support Tools 5713-AEP (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 (C) Copyright Avalon Computer Systems, Inc. 1984, 1987 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 X-Windows Image Adapter/A Device Driver. Version 1.3.0 (C) Copyright International Business Machines Corporation 1990, 1992 (C) Copyright Massachusetts Institute of Technology 1985, 1988 (C) Copyright Digital Equipment Corporation 1985, 1988 (C) Copyright Donald E. Knuth 1985 All Rights Reserved US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Operating System Version 1.3.0 Asynchronous Terminal Emulation 5713-AEQ (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Operating System Version 1.3.0 Graphics Support Library 5713-AEQ (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 (C) Copyright Graphics Software Systems, Inc. 1984, 1988 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Extended C Language. Version 1.2.1 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- IBM AIX PS/2 Text Formatting System Version 1.3.0 5713-AFD (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. -------------------- Toolki kT2$~++߯-~./lpp_nameadmn Administrative Support(PS2) extp Extended User Support(PS2) man Manual Pages(PS2) adst Adv. Dev. Support Tools(PS2) ibm-iaa IBM Image Adapter Driver(PS2) ate Asynch. Terminal Emul.(PS2) gsl Graphics Support Library(PS2) mcc HighC Compiler(PS2) tfs Text Formatting System(PS2) kꢇ 7AT"+쯄-쯄-./usrna kpgA'+௄-௄-./usr/sys kN4A+ᯄ-ᯄ-./usr/sys/inst_updt k PAT"+㯄-㯄- ./usr/lppinst_u k:lRA#++௄-./usr/lpp/admnu kT+ě+ᯄ-./usr/sys/inst_updt/control! admn_vrl/ 737254047 2 2 100666 16 ` 01 30 0013 0000 lppsize/ 737254318 0 0 100644 1060 ` 0000 0013 admn 315 0 0 320 0 4 0 336 0 4 0 132 admn 315 0 0 320 0 4 0 336 0 4 0 132 0000 0013 extp 125 0 0 128 0 1 0 128 0 1 0 128 extp 125 0 0 128 0 1 0 128 0 1 0 128 0000 0013 man 47 0 13 56 0 4 0 216 0 17 0 88 man 47 0 13 56 0 4 0 216 0 17 0 88 0000 0013 adst 582 760 15 532 72 15 9 556 80 19 11 340 adst 582 760 15 532 72 15 9 556 80 19 11 340 0000 0013 ibm-iaa 127 760 4 92 44 3 3 96 52 3 4 72 ibm-iaa 127 760 4 92 44 3 3 96 52 3 4 72 0000 0013 ate 143 0 0 144 0 1 0 144 0 1 0 144 ate 143 0 0 144 0 1 0 144 0 1 0 144 0000 0013 gsl 574 744 93 476 100 1 93 476 100 1 93 476 gsl 574 744 93 476 100 1 93 476 100 1 93 476 0000 0013 mcc 320 0 0 320 0 1 0 324 0 1 0 324 mcc 320 0 0 320 0 1 0 324 0 1 0 324 0000 0013 tfs 283 0 0 292 0 4 0 332 0 4 0 92 tfs 283 0 0 292 0 4 0 332 0 4 0 92 admn_instr/ 737254047 2 2 100666 558 ` ! ui.01.30.0013/ 737254047 2 2 100666 489 ` User instructions for update 01.30.0013 to LPP admn: Configurable file "./usr/lib/terminfo/dec.ti" is being updated, the current version will be retained and the new version will be named: "./usr/lib/terminfo/dec.ti.new.admn". Due to the nature of this update, it is not possible to edit the active copy of this file automatically. Hence, after reviewing this change, if you wish to include this update in your system, it will be necessary to edit the changes into this file. ctarp/ 737254328 0 0 100644 256000 ` ./0000755000000000000000000000000005374315642011563 5ustar00rootsystem00000000000000./usr/0000755000000200000020000000000005374315642011411 5ustar00binbin00000000000000./usr/lpp/0000755000000200000020000000000005374315664012210 5ustar00binbin00000000000000./usr/lpp/tfs/0000755000000200000020000000000005374315643013001 5ustar00binbin00000000000000./usr/lpp/tfs/inst_updt/0000755000000200000020000000000005374315643015012 5ustar00binbin00000000000000./usr/lpp/tfs/inst_updt/arp0000666000000200000020000005134405374315643015532 0ustar00binbin00000000000000! copyright/ 737254305 2 2 100666 627 ` IBM AIX PS/2 Text Formatting System Version 1.3.0 5713-AFD (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254305 2 2 100666 90 ` ./usr/lib/bldtab ./usr/lib/spell/hashmake ./usr/lib/spell/spellinprg ./usr/lib/suftabmake update/ 737254305 2 2 100777 20313 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/tfs/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/tfs " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/tfs/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV tfs || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST tfs status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.tfs" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.tfs\" and then" echo "\t\t\"$file.old.tfs\" => \"$file\"" cp $file "$file.new.tfs" mv "$file.old.tfs" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/tfs/inst_updt/relink RELINK=/usr/lpp/tfs/inst_updt.save/relink COPYTEMP=/usr/lpp/tfs/inst_updt/tmpcopy TMPSAV=/usr/lpp/tfs/inst_updt/tmpsav TMPDEL=/usr/lpp/tfs/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/tfs/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/tfs/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for tfs ..." else echo "Starting the update script for tfs ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script ate script for tfs ..." else echo "Starting the update script for tfs ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unfl./usr/lpp/tfs/prereq0000666000000200000020000000004705374315643014227 0ustar00binbin00000000000000oscrit tfs r v=01 r=30 l=13 o >13 N5!N*خ*Th**@EA+(@@Na./usr/lpp/mcc/0000755000000200000020000000000005374315662012750 5ustar00binbin00000000000000./usr/lpp/mcc/inst_updt/0000755000000200000020000000000005374315661014760 5ustar00binbin00000000000000./usr/lpp/mcc/inst_updt/arp0000666000000200000020000005122205374315575015477 0ustar00binbin00000000000000! copyright/ 737254266 2 2 100666 619 ` IBM AIX PS/2 Extended C Language. Version 1.2.1 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254267 2 2 100666 15 ` ./usr/bin/mdbx update/ 737254267 2 2 100777 20313 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/mcc/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/mcc " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/mcc/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV mcc || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST mcc status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.mcc" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.mcc\" and then" echo "\t\t\"$file.old.mcc\" => \"$file\"" cp $file "$file.new.mcc" mv "$file.old.mcc" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/mcc/inst_updt/relink RELINK=/usr/lpp/mcc/inst_updt.save/relink COPYTEMP=/usr/lpp/mcc/inst_updt/tmpcopy TMPSAV=/usr/lpp/mcc/inst_updt/tmpsav TMPDEL=/usr/lpp/mcc/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/mcc/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/mcc/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for mcc ..." else echo "Starting the update script for mcc ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script ate script for mcc ..." else echo "Starting the update script for mcc ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update sc./usr/lpp/mcc/prereq0000666000000200000020000000004705374315574014200 0ustar00binbin00000000000000oscrit mcc r v=01 r=30 l=13 o >13 N5!N*خ*Th**@A+(@@Na./usr/lpp/gsl/0000755000000200000020000000000005374315662012773 5ustar00binbin00000000000000./usr/lpp/gsl/inst_updt/0000755000000200000020000000000005374315662015004 5ustar00binbin00000000000000./usr/lpp/gsl/inst_updt/arp0000666000000200000020000010527605374315514015524 0ustar00binbin00000000000000! copyright/ 737254218 2 2 100666 703 ` IBM AIX PS/2 Operating System Version 1.3.0 Graphics Support Library 5713-AEQ (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 (C) Copyright Graphics Software Systems, Inc. 1984, 1988 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254218 2 2 100666 6252 ` ./usr/lib/ogsl.txt ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libgsl.a/gspgrt1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/allotcache1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/annotgetloc.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/bcopy.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/get_loc.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspbegend1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspblt1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspciaa1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcira1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcirc1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspclr1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcmp1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcuma1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcura1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspdtxg1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspdtxt1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspecr1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspecur1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspelaa1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspell1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspella1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspella1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfcir1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfell1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfla1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfply1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspgpl.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspgrt1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplan1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplan1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplin1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplin1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplna1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplna1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplop1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplop1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcrm1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcrm1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcur1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcur1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmul1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspoly1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspoly1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppbe1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppen1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppflcache.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspplr1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmk1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmk1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmka1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmka1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppos1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspqgf1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprcrcache.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspretr1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprsav1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprsav1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprtf1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprtf1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsavxy1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspscrcache.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspscur1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsflcache.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsig1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspspos1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspss1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubmn1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubmp1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubn1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubp1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubt1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspterm1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspterm1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptile1v.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxga1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxga1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxta1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxta1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspulns1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspulns1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsputils1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspwait.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtfr1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtvr1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxa1b.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxa1ex.o ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxt1ex.o lpp.acf/ 737254218 2 2 100666 7999 ` ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libgsl.a/gspgrt1ex.o /usr/lib/libgsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/allotcache1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/annotgetloc.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/bcopy.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/get_loc.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspbegend1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspblt1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspciaa1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcira1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcirc1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspclr1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcmp1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcuma1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspcura1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspdtxg1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspdtxt1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspecr1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspecur1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspelaa1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspell1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspella1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspella1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfcir1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfell1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfla1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspfply1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspgpl.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspgrt1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspinit1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplan1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplan1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplin1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplin1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplna1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplna1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplop1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsplop1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcrm1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcrm1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcur1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmcur1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspmul1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspoly1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspoly1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppbe1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppen1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppflcache.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspplr1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmk1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmk1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmka1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppmka1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsppos1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspqgf1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprcrcache.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspretr1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprrst1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprsav1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprsav1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprtf1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsprtf1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsavxy1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspscrcache.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspscur1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsflcache.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsig1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspspos1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspss1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubmn1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubmp1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubn1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubp1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspsubt1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspterm1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspterm1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptile1v.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxga1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxga1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxta1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsptxta1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspulns1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspulns1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gsputils1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspwait.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtfr1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtvr1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxa1b.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxa1ex.o /usr/lib/libogsl.a ./usr/lpp/gsl/inst_updt/lpp.archives/usr/lib/libogsl.a/gspxtxt1ex.o /usr/lib/libogsl.a update/ 737254218 2 2 100777 20313 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/gsl/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/gsl " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/gsl/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV gsl || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST gsl status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.gsl" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.gsl\" and then" echo "\t\t\"$file.old.gsl\" => \"$file\"" cp $file "$file.new.gsl" mv "$file.old.gsl" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/gsl/inst_updt/relink RELINK=/usr/lpp/gsl/inst_updt.save/relink COPYTEMP=/usr/lpp/gsl/inst_updt/tmpcopy TMPSAV=/usr/lpp/gsl/inst_updt/tmpsav TMPDEL=/usr/lpp/gsl/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/gsl/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/gsl/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for gsl ..." else echo "Starting the update script for gsl ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script ate script for gsl ..." else echo "Starting the update script for gsl ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore ./usr/lpp/gsl/prereq0000666000000200000020000000004705374315514014215 0ustar00binbin00000000000000oscrit gsl r v=01 r=30 l=13 o >13 N5!N*خ*Th**@SA+(@@Na./usr/lpp/ate/0000755000000200000020000000000005374315662012757 5ustar00binbin00000000000000./usr/lpp/ate/inst_updt/0000755000000200000020000000000005374315662014770 5ustar00binbin00000000000000./usr/lpp/ate/inst_updt/arp0000666000000200000020000005126205374315450015502 0ustar00binbin00000000000000! copyright/ 737254182 2 2 100666 653 ` IBM AIX PS/2 Operating System Version 1.3.0 Asynchronous Terminal Emulation 5713-AEQ (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254182 2 2 100666 14 ` ./usr/bin/ate update/ 737254182 2 2 100777 20313 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/ate/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/ate " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/ate/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV ate || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST ate status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.ate" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.ate\" and then" echo "\t\t\"$file.old.ate\" => \"$file\"" cp $file "$file.new.ate" mv "$file.old.ate" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/ate/inst_updt/relink RELINK=/usr/lpp/ate/inst_updt.save/relink COPYTEMP=/usr/lpp/ate/inst_updt/tmpcopy TMPSAV=/usr/lpp/ate/inst_updt/tmpsav TMPDEL=/usr/lpp/ate/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/ate/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/ate/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for ate ..." else echo "Starting the update script for ate ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script ate script for ate ..." else echo "Starting the update script for ate ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq./usr/lpp/ate/prereq0000666000000200000020000000004705374315450014200 0ustar00binbin00000000000000oscrit ate r v=01 r=30 l=13 o >13 N5!N*خ*Th**@:A+(@@Na./usr/lpp/ibm-iaa/0000755000000200000020000000000005374315663013506 5ustar00binbin00000000000000./usr/lpp/ibm-iaa/inst_updt/0000755000000200000020000000000005374315662015516 5ustar00binbin00000000000000./usr/lpp/ibm-iaa/inst_updt/arp0000666000000200000020000005335005374315410016224 0ustar00binbin00000000000000! copyright/ 737254148 2 2 100666 679 ` IBM AIX PS/2 X-Windows Image Adapter/A Device Driver. Version 1.3.0 (C) Copyright International Business Machines Corporation 1990, 1992 (C) Copyright Massachusetts Institute of Technology 1985, 1988 (C) Copyright Digital Equipment Corporation 1985, 1988 (C) Copyright Donald E. Knuth 1985 All Rights Reserved US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a trademark of International Business Machines Corporation. al_01.30.0013/ 737254148 2 2 100666 432 ` ./usr/lpp/ibm-iaa/config ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/getpasswd.o ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/setlocale.o ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/settimeofd.o ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/settimeofday.o ./usr/lpp/ibm-iaa/lpp.linkX/iaaX.o ./usr/lpp/ibm-iaa/lpp.loc/files/local/ibm-iaa/lpp.config/config lpp.acf/ 737254149 2 2 100666 404 ` ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/getpasswd.o /usr/lpp/ibm-iaa/libc.a ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/setlocale.o /usr/lpp/ibm-iaa/libc.a ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/settimeofd.o /usr/lpp/ibm-iaa/libc.a ./usr/lpp/ibm-iaa/inst_updt/lpp.archives/usr/lpp/ibm-iaa/libc.a/settimeofday.o /usr/lpp/ibm-iaa/libc.a update/ 737254149 2 2 100777 20389 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/ibm-iaa/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/ibm-iaa " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/ibm-iaa/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV ibm-iaa || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST ibm-iaa status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.ibm-iaa" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.ibm-iaa\" and then" echo "\t\t\"$file.old.ibm-iaa\" => \"$file\"" cp $file "$file.new.ibm-iaa" mv "$file.old.ibm-iaa" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/ibm-iaa/inst_updt/relink RELINK=/usr/lpp/ibm-iaa/inst_updt.save/relink COPYTEMP=/usr/lpp/ibm-iaa/inst_updt/tmpcopy TMPSAV=/usr/lpp/ibm-iaa/inst_updt/tmpsav TMPDEL=/usr/lpp/ibm-iaa/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/ibm-iaa/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/ibm-iaa/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for ibm-iaa ..." else echo "Starting the update script for ibm-iaa ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script loc_01.30.0013/ 737254149 2 2 100666 34 ` ./local/ibm-iaa/lpp.config/config "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script com./usr/lpp/ibm-iaa/lpp.loc/0000755000000200000020000000000005374315663015055 5ustar00binbin00000000000000./usr/lpp/ibm-iaa/lpp.loc/info0000666000000200000020000000003505374315407015731 0ustar00binbin00000000000000a ibm-iaa 12 01.30.0013.0000 15055i do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script loc_01.30.0013/ 737254149 2 2 100666 34 ` ./locaJnfig5!JUREST" != "deferred" ]; then do_save_symlinks do_save # s_speake any @<A ++L!+!(@Ja./usr/lpp/ibm-iaa/lpp.loc/inst_updt.loc0000777000000200000020000001703005374315407017571 0ustar00binbin00000000000000#!/bin/sh # SCCSID(@(#)inst_updt_loc 1.2.1.4 AIX) Modified: 12/4/90 12:16:59 # # Template for local update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 machine_type i386 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST fi } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV /etc/lpp/insvl $TMPSAV ibm-iaa || cleanup $? return 0 } # Restore new files from media do_restore() { /etc/inurest -q -d "$DEV" "$RESTLIST" "ibm-iaa" || cleanup $? return 0 } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file fi done } # Initialization routine initialize() { CURDIR=`pwd` RESTLIST=$CURDIR/al.loc SAVLIST=$RESTLIST DEV=$CURDIR/bac TMPSAV=/tmp/tmpsav.$$ TMPDEL=/tmp/tmpdel.$$ } # Routine to cleanup temporary files and exit cleanup() { rm -f "$TMPSAV" exit ${1:-0} } # # Main # initialize "$1" "$2" manifest do_save do_delete do_restore cleanup $ECODE # end of local update script MPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file fi done } # Initialization routine initialize() { CURDIR=`pwd` RESTLIST=$CURDIR/al.loc SAVLIST=$RESTLIST DEV=$CURDIR/bac TMPSAV=/tmp/tmpsav.$$ TMPDEL=/tmp/tmpdel.$$ } # Routine to cleanup temporary files and exit cleanup() { rm -f "$TMPSAV" exit ${1:-0} } # # Main # initialize "$1" "$2" manifest do_save do_delete do_restore cleanup $ECODE # end./usr/lpp/ibm-iaa/lpp.loc/lpp.hist0000666000000200000020000000012005374315407016532 0ustar00binbin00000000000000a ibm-iaa 01.30.0013.0000 * e | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file fi done } # Initialization routine initialize() {JREST5!JSTLIST DEV=$CURDIR/bac TMPSAV=/tmp/tmpsav.$$ TMPDEL=/tmp/tmpdel.$$ } # Routine to cleanup temporary files and exit cleanup() { rm -f "$<A +0 (@@Ja./usr/lpp/ibm-iaa/prereq0000666000000200000020000000004705374315407014730 0ustar00binbin00000000000000oscrit ibm-iaar v=01 r=30 l=13 o >13 R5!R*خ*Th**@A+(@@Ra./usr/lpp/adst/0000755000000200000020000000000005374315663013142 5ustar00binbin00000000000000./usr/lpp/adst/inst_updt/0000755000000200000020000000000005374315663015153 5ustar00binbin00000000000000./usr/lpp/adst/inst_updt/arp0000666000000200000020000007371205374315341015667 0ustar00binbin00000000000000! copyright/ 737254110 2 2 100666 726 ` IBM AIX PS/2 Application Development Toolkit Version 1.3.0 Advanced Development Support Tools 5713-AEP (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 (C) Copyright Avalon Computer Systems, Inc. 1984, 1987 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254111 2 2 100666 1169 ` ./usr/bin/bs ./usr/bin/cflow ./usr/bin/dbx ./usr/include/NLregexp.h ./usr/include/sys/dktrace.h ./usr/include/sys/hft/physdisp.h ./usr/include/sys/i386/com232.h ./usr/include/sys/i386/ibmscsi.h ./usr/include/sys/i386/pos.h ./usr/include/sys/if_slvar.h ./usr/include/sys/if_types.h ./usr/include/sys/ioctl.h ./usr/include/sys/machinfo.h ./usr/include/sys/slcompress.h ./usr/lib/llib-lc.ln ./usr/lib/llib-ldos.ln ./usr/lib/llib-lm.ln ./usr/lib/llib-lmalloc.ln ./usr/lib/llib-port.ln ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/getpasswd.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/setlocale.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/settimeofd.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/settimeofday.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/getpasswd.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/setlocale.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/settimeofd.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/settimeofday.o ./usr/lpp/adst/inst_updt/lpp.archives/lib/libm.a/fmod.o ./usr/lpp/adst/inst_updt/lpp.archives/usr/lib/libcur.a/ecpnin.o ./usr/lpp/adst/inst_updt/lpp.archives/usr/lib/libcur.a/endwin.o lpp.acf/ 737254111 2 2 100666 840 ` ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/getpasswd.o /lib/libc.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/setlocale.o /lib/libc.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/settimeofd.o /lib/libc.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/settimeofday.o /lib/libc.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/getpasswd.o /lib/libc_s.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/setlocale.o /lib/libc_s.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/settimeofd.o /lib/libc_s.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc_s.a/settimeofday.o /lib/libc_s.a ./usr/lpp/adst/inst_updt/lpp.archives/lib/libm.a/fmod.o /lib/libm.a ./usr/lpp/adst/inst_updt/lpp.archives/usr/lib/libcur.a/ecpnin.o /usr/lib/libcur.a ./usr/lpp/adst/inst_updt/lpp.archives/usr/lib/libcur.a/endwin.o /usr/lib/libcur.a update/ 737254111 2 2 100777 20371 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 delete_symlink ./usr/include/dktrace.h end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/adst/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/adst " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/adst/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV adst || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST adst status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.adst" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.adst\" and then" echo "\t\t\"$file.old.adst\" => \"$file\"" cp $file "$file.new.adst" mv "$file.old.adst" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/adst/inst_updt/relink RELINK=/usr/lpp/adst/inst_updt.save/relink COPYTEMP=/usr/lpp/adst/inst_updt/tmpcopy TMPSAV=/usr/lpp/adst/inst_updt/tmpsav TMPDEL=/usr/lpp/adst/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/adst/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/adst/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for adst ..." else echo "Starting the update script for adst ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script appscr.0013/ 737254111 2 2 100777 5356 ` # # SCCSID(@(#)appscr_level 1.2.1.4 AIX) Modified: 10/24/91 15:52:30 # # # this is the apply script # # Its purpose is to make special case updates that can be accomplished # after the normal update. Typically it is used to deal with the # cases where there are no actual new bits, but perhaps just changes # to file attributes. # # Note that anything done here should be able to be done multiple times # without danger of breaking. For example, if a change involves # putting a specific line at the end of a file, first test to see if # that line is already there. # # Also note that anything done here must be reversible. The appropriate # actions must be placed in the reject script # #-------------------------------------------------------------------------- # It isn't a good idea to interrupt the script. Interrupts will trap to here. # This needs work... If an interrupt is received, the shell traps to here, # but then exits anyway. # on_intr() { echo "\007Cannot interrupt apply script." } #-------------------------------------------------------------------------- # initialize various things # initial() { GOOD=0 BAD=1 CHFSTORE=chfstore CHOWN=chown CHGRP=chgrp CHMOD=chmod RECEXEC=/usr/lpp/adst/inst_updt.save/recover.0013 : >$RECEXEC # initialize to be an empty file $CHMOD +x $RECEXEC flist=/usr/lpp/adst/inst_updt/change_attr } #-------------------------------------------------------------------------- # put files that need attribute modification in the list (before the ~~EOF~~) # They must be followed by their new attributes as follows: # name fstore mode owner group # There should be something here to change hidden directories to flat and # vice versa. (Handled in 'update' 11/17/89) # # the file names should be relative to the root, i.e. # ./bin/rm@/i386 # ./usr/include/junk.h # init_flist() { cat >$flist <<~~EOF~~ ~~EOF~~ } #-------------------------------------------------------------------------- # modify the mode (as given by ls -l) to produce something useful to # the chmod command # Note that we must remove -'s and S must be changed to s. # munge_mode() { # munge_fmode umode=`expr X$1 : "X.\(...\)"` gmode=`expr X$1 : "X....\(...\)"` omode=`expr X$1 : "X.......\(...\)"` echo "u=$umode,g=$gmode,o=$omode" | tr -d - | tr S s } #-------------------------------------------------------------------------- # collect the attributes of the file as it currently exists # getold_attr() { # See if we are on a TCF enabled site and set the 'ls' flags accordingly. ls -z /dev/null 2>1 > /dev/null if [ $? -eq 0 ]; then lsflags="-HNzdl" else lsflags="-HNdl" fi set `ls $lsflags $file` oldfstore=$1 oldmode=$2 # handle >9 links, when the link field overflows into the mode field if [ 12 -eq `expr "$oldmode" : ".*"` ]; then # we have overflow, normally the mode field is 10 characters oldmode=`expr "$oldmode" : "\(..........\)"` oldowner=$3 oldgroup=$4 else oldowner=$4 oldgroup=$5 fi } #-------------------------------------------------------------------------- # see if the new attributes are different from the old # check_attr() { [ "X$oldfstore" = "X$newfstore" ] && newfstore="" [ "X$oldmode" = "X$newmode" ] && newmode="" [ "X$oldowner" = "X$newowner" ] && newowner="" [ "X$oldgroup" = "X$newgroup" ] && newgroup="" } #-------------------------------------------------------------------------- # add to the file to reverse the changes we are about to make # make_recovery() { if [ "" != "$newfstore" ]; then echo "[ -x $CHFSTORE ] && $CHFSTORE $oldfstore $file" \ >> $RECEXEC fi if [ "" != "$newmode" ]; then newmode=`munge_mode $newmode` oldmode=`munge_mode $oldmode` echo "$CHMOD $oldmode $file" >> $RECEXEC fi [ "" = "$newowner" ] || echo "$CHOWN $oldowner $file" >> $RECEXEC [ "" = "$newgroup" ] || echo "$CHGRP $oldgroup $file" >> $RECEXEC } #-------------------------------------------------------------------------- # change the attributes of files as necessary # change_attr() { if [ ! -z "$newfstore" -a -x /usr/bin/chfstore ]; then $CHFSTORE $newfstore $file fi [ "" = "$newmode" ] || $CHMOD $newmode $file [ "" = "$newowner" ] || $CHOWN $newowner $file [ "" = "$newgroup" ] || $CHGRP $newgroup $file } #-------------------------------------------------------------------------- # change file attributes where necessary, and build a script to reverse # the process # change_file_modes() { [ -s $flist ] || return 1 # If $flist file is empty, bail out. nf=`wc -l $flist | tr -d " "` # $nf gets count of files in $flist. echo "Changing attributes on $nf files..." # Loop through files in $flist while read file newfstore newmode newowner newgroup; do nf=`expr $nf - 1` # Decrement file count # Let operator know we are still alive. [ `expr $nf % 25` -eq 0 ] && echo "$nf \c" # don't do anything if the file is not found ls -Nd $file >/dev/null 2>&1 || continue echo "# restore attributes of $file" >>$RECEXEC getold_attr check_attr make_recovery change_attr done <$flist echo "\nChange attributes: complete" } #-------------------------------------------------------------------------- # Main routine for apply scripts # trap on_intr 2 3 15 initial init_flist # list of files needing attribute changes change_file_modes exit $GOOD rejscr.0013/ 737254112 2 2 100777 1834 ` # SCCSID(@(#)rejscr_level 1.3.1.2 AIX) Modified: 7/7/90 20:00:18 # # this is the reject script # # Its purpose is to reverse special case updates performed by the apply script. # Attributes changes for files entered in the flist of the apply script # will be reversed automatically by this script. However, changes made # outside this framework must be undone by lines placed in the edfile() # function below. # #-------------------------------------------------------------------------- # It isn't a good idea to interrupt the script. Interrupts will trap to here. # This needs work... If an interrupt is received, the shell traps to here, # but then exits anyway. # on_intr() { echo "\007Cannot interrupt apply script." } #-------------------------------------------------------------------------- # initialize various things # initial() { LPP="" GOOD=0 BAD=1 CHFSTORE=chfstore CHOWN=chown CHGRP=chgrp CHMOD=chmod RECEXEC=/usr/lpp/adst/inst_updt.save/recover.0013 RELINK=/usr/lpp/adst/inst_updt.save/relink } #-------------------------------------------------------------------------- # Recover old file modes - as set in recover file by apply script. # recv_file_modes() { if [ -x $RECEXEC ] then sh "$RECEXEC" fi } #-------------------------------------------------------------------------- # Restore any sym-links that 'update' broke - as set in relink file # by update script. # rest_symlinks() { if [ -x $RELINK ] then sh "$RELINK" chmod -x $RELINK # only one reject script need run it fi } #-------------------------------------------------------------------------- # Routine to edit/modifiy files # edfile() { : } #-------------------------------------------------------------------------- # Main routine for apply scripts # initial recv_file_modes edfile rest_symlinks exit $GOOD ----- # Restore any sym-links that 'update' broke - as./usr/lpp/adst/prereq0000666000000200000020000000004705374315341014361 0ustar00binbin00000000000000oscrit adst r v=01 r=30 l=13 o >13 O5!O*خ*Th**@0A+(@@Oa./usr/lpp/man/0000755000000200000020000000000005374315663012762 5ustar00binbin00000000000000./usr/lpp/man/inst_updt/0000755000000200000020000000000005374315663014773 5ustar00binbin00000000000000./usr/lpp/man/inst_updt/arp0000666000000200000020000005215205374315310015476 0ustar00binbin00000000000000! copyright/ 737254086 2 2 100666 645 ` IBM AIX PS/2 Operating System Extensions Version 1.3.0 Manual Pages 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254086 2 2 100666 434 ` ./usr/man/cat1/cp.1 ./usr/man/cat1/find.1 ./usr/man/cat1/ksh.1 ./usr/man/cat1/more.1 ./usr/man/cat1/pepsy.1 ./usr/man/cat3/libicompat.3 ./usr/man/cat3/libpsap.3 ./usr/man/cat3/libtsap.3n ./usr/man/cat5/isoaliases.5 ./usr/man/cat5/isobjects.5 ./usr/man/cat5/isoentities.5 ./usr/man/cat5/isomacros.5 ./usr/man/cat5/isoservices.5 ./usr/man/cat5/isotailor.5 ./usr/man/cat5/sendmail.cf.5 ./usr/man/cat8/snmpt.8c ./usr/man/man8/sliplogin.8 update/ 737254087 2 2 100777 20341 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 delete ./usr/man/man1/ksh.1 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/man/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/man " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/man/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV man || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST man status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.man" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.man\" and then" echo "\t\t\"$file.old.man\" => \"$file\"" cp $file "$file.new.man" mv "$file.old.man" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/man/inst_updt/relink RELINK=/usr/lpp/man/inst_updt.save/relink COPYTEMP=/usr/lpp/man/inst_updt/tmpcopy TMPSAV=/usr/lpp/man/inst_updt/tmpsav TMPDEL=/usr/lpp/man/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/man/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/man/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for man ..." else echo "Starting the update script for man ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script ate script for man ..." else echo "Starting the update script for man ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 f./usr/lpp/man/prereq0000666000000200000020000000004705374315310014175 0ustar00binbin00000000000000oscrit man r v=01 r=30 l=13 o >13 N5!N*خ*Th**@-A6+(@@Na./usr/lpp/extp/0000755000000200000020000000000005374315664013170 5ustar00binbin00000000000000./usr/lpp/extp/inst_updt/0000755000000200000020000000000005374315664015201 5ustar00binbin00000000000000./usr/lpp/extp/inst_updt/arp0000666000000200000020000005133405374315261015711 0ustar00binbin00000000000000! copyright/ 737254062 2 2 100666 661 ` IBM AIX PS/2 Operating System Extensions Version 1.3.0 Extended Programming Support 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254063 2 2 100666 29 ` ./usr/nifl/rtmc/bin/386.rtmc update/ 737254063 2 2 100777 20332 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/extp/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/extp " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/extp/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV extp || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST extp status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.extp" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.extp\" and then" echo "\t\t\"$file.old.extp\" => \"$file\"" cp $file "$file.new.extp" mv "$file.old.extp" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/extp/inst_updt/relink RELINK=/usr/lpp/extp/inst_updt.save/relink COPYTEMP=/usr/lpp/extp/inst_updt/tmpcopy TMPSAV=/usr/lpp/extp/inst_updt/tmpsav TMPDEL=/usr/lpp/extp/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/extp/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/extp/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for extp ..." else echo "Starting the update script for extp ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script te script for extp ..." else echo "Starting the update script for extp ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten ./usr/lpp/extp/prereq0000666000000200000020000000004705374315260014406 0ustar00binbin00000000000000oscrit extp r v=01 r=30 l=13 o >13 O5!O*خ*Th**@*A(+(@@Oa./usr/lpp/admn/0000755000000200000020000000000005374315664013127 5ustar00binbin00000000000000./usr/lpp/admn/inst_updt/0000755000000200000020000000000005374315664015140 5ustar00binbin00000000000000./usr/lpp/admn/inst_updt/arp0000666000000200000020000005144405374315236015654 0ustar00binbin00000000000000! copyright/ 737254044 2 2 100666 655 ` IBM AIX PS/2 Operating System Extensions Version 1.3.0 Administrative Support 5713-AFH (C) Copyright International Business Machines Corporation 1988, 1989, 1990, 1992 All Rights Reserved Licensed Material - Property of International Business Machines Corporation US Government Users Restricted Rights - Use, duplication or disclosure is restricted by GSA ADP Schedule Contract with International Business Machines Corporation. IBM is a registered trademark of International Business Machines Corporation. AIX is a trademark of International Business Machines Corporation. PS/2 is a registered trademark of International Business Machines Corporation. al_01.30.0013/ 737254044 2 2 100666 69 ` ./usr/bin/ff ./usr/bin/fuser ./usr/bin/tic ./usr/lib/terminfo/dec.ti update/ 737254044 2 2 100777 20369 ` #!/bin/sh # SCCSID(@(#)update 1.6.1.15 AIX) Modified: 1/22/92 17:25:27 # # Template for update scripts # # In general, this script should do the job. Any special processing # should go in the apply and reject scripts. Various special return # codes can cause special post-processing actions (like reboots). # # This script is able to handle certain pathological cases which fall # into several categories. Functions are provided to declare whether # any such cases apply and which files (if any) are affected. Using these # functions ensures that the correct processing occurs. Declarations # (ie invocations of the provided functions) should be made below in the # manifest() function. The special cases are: # # 1. Script return code - exit_code(). # This will usually be NORM, the default - updatep proceeds. # However, it can subsequently be set to CANCEL if, for example, # special code finds it necessary to cancel the update without # error, or to ECANCEL if an error occurs and to abort. # KBLDMANREB and KBLDAUTREB apply only to the local updates but # are included below for completeness. # # 2. Specific machine type - machine_type() # If machine type specific update is required, this may be # assured with the machine_type call. The type may be one or more # of i386, B370, XA370 separated by commas, i.e. # machine_type "B370,XA370" # # 3. File deletions - delete() # Files which should be deleted as part of the update procedure. # Do not put files in this list that are in another LPP. Deleting # them is incorrect if the other LPP is installed when this # update is applied. # # 4. Rename current version - rename_old() # Files, particularly user-configurable files such as /etc/sites, # for which a copy of the original should be retained. For # example, after update there would be a new /etc/sites and the # original would be in /etc/sites.old.. Backup/restore # is used to copy the file. # # 5. Rename new version - rename_new() # Files, particularly user-configurable files such as # /etc/passwd, for which the original should not be replaced. # For example, after the update the old /etc/passwd would still # be in place, and the new one would be in # /etc/passwd.new.. # # 6. Active file - active() # Files such as the updatep scripts, which are active at the time # of the update. These are copied aside to avoid the update # overwriting the active copies. Note that these updates can # only be rejected successfully if an apply/reject script pair # is provided with the update. # # 7. Convert flat to hidden - make_hidden() # Executable files which are currently flat files but which # are to be updated with hidden directories. Before these are # restored they should be converted - unflattened. This list # should contain filename followed by the cpu_type to be # assigned to the fstore of the hidden directory created. # Note that this is process will not be reversed if the # update is subsequently rejected. # # 8. Change or delete symlink - symlink() or delete_symlink() # This lists all symbolic links which are being deleted entirely, # replaced by a real file, or replaced by a link to a different # file (existing or new). This special processing is necessary to # circumvent inadequacies in the way backup/restore handles # symbolic links - in particular: restore will restore through # existing links. Entries in this are link filename # followed by: the target name of the new link;the fstore # value; the owner; and the group of the link. Note that # these updates can only be rejected successfully if an # apply/reject script pair is provided with the update. # # 9. special() # This final category is a catchall for files requiring # special handling not covered above. Lines should be added # in the do_special() function as needed, but any file processed # there should be entered in this list to ensure that the # existing copy may be restored in the event of a failure of # the update process. # # 10. no_deferred_restore() # This overrides the default action of requesting a deferred # restore. That is, if this function is invoked a deferred restore # will not be attempted for this LPP. Additionally, function # deferred_restore() sets the default and can be used to override # the override in a cumulative PTF [the latest level takes # precedence]. # # In addition, function VRL() is used to delimit declarations to certain # VRL levels (although only the 'L' is significant). Declarations # following a VRL invocation will be applied only if the target system # has not already been updated to this level. Hence, the ordering of # declarations is important and must be in update level order. # # Declarations of the type listed above must be placed in the manifest # function below. An example might be: # # manifest() # { # begin_lists # VRL 01.02.0001 # delete ./bin/junk@/i386 # active ./etc/restore@/i386 # VRL 01.02.0004 # symlink ./etc/link linked_to i386 sys sys # end_lists # } # Switch on tracing if debugging has been requested. [ $INUDEBUG ] && echo "$INUDEBUG" | grep -sw "`basename $0`" && set -x # Exit code definitions codes: NORM=0 # normal, no error FLUSH=2 KBLDMANREB=3 # kernel rebuild and manual reboot KBLDAUTREB=4 # kernel rebuild and automatic reboot CANCEL=5 # terminate update, no error ECANCEL=7 # terminate update, failed ECODE=$NORM # default exit code manifest() # # This defines the particular circumstances of the update and lists # the files which fall into the categories described above. # { begin_lists VRL 01.30.0013 rename_new ./usr/lib/terminfo/dec.ti end_lists } # Do any special actions required as setup for this update. # All files that are changed here should go in the SPECIAL_LIST so # the changes can be backed out; or something should be put in the # reject script. # do_special() { [ "$SPECIAL_LIST" ] || return 0 # # Add special code here: # } # # Subroutines # deferred_restore() # # Request deferred restore mode of operation # { # prefix character for $INUREST variable to request deferred restore DEFER="." } no_deferred_restore() # # Override deferred restore mode of operation # { DEFER="" } exit_code() # # Set the script exit code - provided its a higher priority (ie numerically # greater than) the currently set value. # { # skip this if it doesn't apply from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return if [ $1 -gt $ECODE ]; then ECODE=$1 fi } add_to_list() # # Adds trailing arguments to list whose NAME is argument 1. # Null entries are not added to the list. # { # skip this entry if it doesn't apply to an update # from the current level to the new level [ $current_level -lt $dec_level -a $dec_level -le $new_level ] || return [ "$2" ] || return listname=$1 eval listvalue="\$$1" shift root_rel=`expr "X$1" : "X\(\./\).*"` if [ "./" != "$root_rel" ]; then error "root-relative path name required -- ($1)" else eval "$listname=\"$listvalue$* \"" fi } flatten_list() # # Scans the list named by argument 1, flattening all pathnames # (by deleting @[junk]) and removing any duplicate lines thus created. # Note that removal of duplicates involves sorting the list, and this may # affect the order in which the list entries are subsequently processed. # { eval listvalue="\$$1" # dereference the named variable [ "$listvalue" ] || return # forget empty lists listvalue=`echo "$listvalue\c" |\ sed -e "s/@[^ ]*//g" |\ sort -u` eval "$1=\"$listvalue \"" # assign back result (adding trailing newline that `` removes) } delete() { if [ $# -ne 1 ]; then error "delete(): 1 argument required (\"$*\" given)" else add_to_list DELETE_LIST $1 fi } rename_old() { if [ $# -ne 1 ]; then error "rename_old(): 1 argument required (\"$*\" given)" else add_to_list RENAME_OLD_LIST $1 fi } rename_new() { if [ $# -ne 1 ]; then error "rename_new(): 1 argument required (\"$*\" given)" else add_to_list RENAME_NEW_LIST $1 fi } special() { if [ $# -ne 1 ]; then error "special(): 1 argument required (\"$*\" given)" else add_to_list SPECIAL_LIST $1 fi } active() { if [ $# -ne 1 ]; then error "active(): 1 argument required (\"$*\" given)" else add_to_list ACTIVE_LIST $1 fi } make_hidden() { if [ $# -ne 2 ]; then error "make_hidden(): 2 arguments required (\"$*\" given)" else add_to_list UNFLATTEN_LIST $1 $2 fi } delete_symlink() { if [ $# -ne 1 ]; then error "delete_symlink(): 1 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 fi } symlink() { if [ $# -ne 5 ]; then error "symlink(): 5 argument required (\"$*\" given)" else add_to_list SYMLINK_LIST $1 $2 $3 $4 $5 fi } begin_lists() { # Initialize the file lists empty DELETE_LIST="" RENAME_OLD_LIST="" RENAME_NEW_LIST="" ACTIVE_LIST="" UNFLATTEN_LIST="" SYMLINK_LIST="" SPECIAL_LIST="" # The current level of applied service and the new level to which this # update advances are both expected as variables from the environment - # but assign sensible defaults in case these are null. : ${current_level=0000} L=`expr "01.30.0013" : ".*\(....\)$"` : ${new_level=$L} # Set default update level for file declarations VRL 01.30.0013 # Set default restore operation - defer deferred_restore } error() # # Announce an error in file declaration and set the exit code. # Don't abort until all declarations have been checked and other # errors reported. # { echo "File declaration error, $1" ECODE=$ECANCEL } VRL() # # Declares that subsequent lines apply for update level arg 1 # (note that version and release are substituted by Ufiles) # { # Check the given VRL and assign L to level [ "$1" ] || { error "VRL missing"; return; } dec_level=`expr x$1 : "x01\.30\.\([0-9][0-9][0-9][0-9]\)$"` [ "$dec_level" ] || error "bad VRL number: $1" } end_lists() { # Cancel the update with error if file declaration errors detected if [ $ECODE -eq $ECANCEL ]; then echo "... update script aborting" cleanup $ECODE fi # Flatten all pathnames if we are updating a flat system (detected # by whether init is not hidden) if [ ! -h /etc/init ]; then flatten_list DELETE_LIST flatten_list RENAME_OLD_LIST flatten_list RENAME_NEW_LIST flatten_list SPECIAL_LIST flatten_list SYMLINK_LIST fi } is_replicated() # # Determines whether file $1 is system replicated. # This test is performed by attempting the add nothing (0) to the fstore mask # and to retain the original (-o). If the file is not replicated chfstore # returns 1, else it returns 0 without actually doing anything. # The beauty of this test is that it is correct for symlinks too. # { if [ -x /usr/bin/chfstore ]; then chfstore -o 0 $1 >&- 2>&- return $? else return 1 fi } get_attributes() # # Echoes fstore, owner and group attributes for file $1 # { fname=$1 if is_replicated $fname; then set `ls -HNzdl $fname` fstore=$1 shift else set `ls -HNdl $fname` fstore=blank fi if [ `expr "$1" : ".*"` -eq 12 ]; then fowner=$2 fgroup=$3 else fowner=$3 fgroup=$4 fi echo $fname $fstore $fowner $fgroup } set_attributes() # # Generates commands to set the attributes of a file defined by the positional # arguments to this function: # fname fstore fowner fgroup # { fname=$1 fstore=$2 fowner=$3 fgroup=$4 is_replicated "$fname" && echo "chfstore $fstore $fname" echo "chown $fowner $fname" echo "chgrp $fgroup $fname" } do_save_symlinks() # # Save information about symbolic links to be deleted or replaced # { [ "$SYMLINK_LIST" ] || return 0 echo "Saving symbolic link information:" : >$LINKS echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target etc; do if [ "" != "$new_target" ] then echo "rm -s $symlink" >> $LINKS fi if [ -l $symlink ] then # link exists # extract the file it is pointing to old_target=`ls -lN $symlink | sed -n -e "s//\/local/" \ -e "s/.* -> \([^ ]*\)$/\1/p"` echo "ln -s $old_target $symlink" >> $LINKS set_attributes `get_attributes $symlink` >> $LINKS echo "\t$symlink -> \"$old_target\"" rm -s $symlink # delete it fi done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle the awkward cases of active files # Note that during the reject phase these files are explicitly # restored from the (inusave) save file behind the back of the normal # utility script, inurest! # do_active_files() { [ "$ACTIVE_LIST" ] || return 0 [ -s "$LINKS" ] || : > $LINKS # create recovery file if not extant here=`pwd` TEMPDIR=/usr/lpp/admn/tmp.$$ mkdir $TEMPDIR cd $TEMPDIR echo "Restore active files to $TEMPDIR" ACTIVE_LIST=`echo "$ACTIVE_LIST\c" |\ sort -u` # remove duplicates from the ACTIVE_LIST ACTIVE_LIST="$ACTIVE_LIST " # replace the newline that was removed by the `` if [ -h /etc/init ]; then /etc/restore -xqf "$DEV" $ACTIVE_LIST > $LINKS echo "here=\`pwd\`; mkdir $TEMPDIR; cd $TEMPDIR" >> $LINKS echo "/etc/restore -xqf $INUSAVEFILE/admn " $ACTIVE_LIST >> $LINKS # # move them on to the real root # (actually using copy so that the existing fstore is retained) # echo "Now move them to the real root file system" echo "$ACTIVE_LIST\c" | sed 's/^\.//' | while read x; do # * Save the running copy in $x.DELETE_ME # * Set $x.TMP_NEW so that it has the same permission, # fstore value, owner and group id and $x # * Copy the new .$x $x.TMP_NEW so maintain fstore, perm, etc. # * Move $x.TMP_NEW to $x so that the new file, $x.TMP_NEW # is place in the right directory with the right fstore, # permission and ownership while the active copy ($x.DELETE_ME) # still keeps running. ln $x $x.DELETE_ME cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then set `/bin/ls -lz $x` /usr/bin/chfstore $1 $x.TMP_NEW else set `/bin/ls -li $x` fi /bin/chown $4 $x.TMP_NEW; /bin/chgrp $5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME echo " ln $x $x.DELETE_ME set \`/bin/ls -lz $x\` cp $x $x.TMP_NEW if [ -x /usr/bin/chfstore ]; then /usr/bin/chfstore \$1 $x.TMP_NEW fi /bin/chown \$4 $x.TMP_NEW; /bin/chgrp \$5 $x.TMP_NEW cp .$x $x.TMP_NEW mv $x.TMP_NEW $x rm -f $x.DELETE_ME" >> $LINKS done cd $here rm -fr $TEMPDIR echo "cd \$here; rm -fr $TEMPDIR" >> $LINKS } # # unflatten() -- move an executable to a hidden directory # note that the fstore of the hidden directory is set to "all". # usage: unflatten file cpu_type # unflatten() { fnm=$1; cpu=$2 nm=`basename $fnm` [ -h $fnm ] && return 1 mv $fnm $fnm.$$ # get old file out of the way mkdir -h $fnm # create new hidden directory chfstore all $fnm@ # fix fstore chown bin $fnm@ chgrp bin $fnm@ chmod 755 $fnm@ mv $fnm.$$ $fnm@/$cpu } # # Process $UNFLATTEN_LIST. # do_unflatten() { [ "$UNFLATTEN_LIST" ] || return 0 echo "Moving executable files into hidden directories:" echo "$UNFLATTEN_LIST\c" | sed 's/^\.//' | \ while read file cpu_type; do echo "\t\"$file\"" unflatten $file $cpu_type done return 0 } # Make sure update runs only on chosen machine types machine_type() { [ "" = "$1" ] && return 0 # null means all machines ok type=`uname -m` # return ok only if machine type is in the MTYPE list expr ",$1," : ".*,$type," >/dev/null || cleanup $CANCEL return 0 } # Save old versions of files before restoring new files do_save() { cat $SAVLIST >$TMPSAV [ "$SPECIAL_LIST" != "" ] && echo "$SPECIAL_LIST\c" >>$TMPSAV [ "$DELETE_LIST" != "" ] && echo "$DELETE_LIST\c" >>$TMPSAV # get rid of a bunch of files we know won't be there to be saved grep -v '^./usr/lpp/admn/inst_updt/lpp.archives/' $TMPSAV | \ sort -u -o $TMPSAV nfiles=`wc -l $TMPSAV | tr -d " "` echo "Save the existing files: at most $nfiles files" /etc/inusave $TMPSAV admn || cleanup $? return 0 } # Restore new files from media unless a defer is possible do_restore() { nfiles=`wc -l $RESTLIST | tr -d " "` echo "Restoring the updates: $nfiles files ..." INUREST=$DEFER$INUREST /etc/inurest -q -d $DEV $RESTLIST admn status=$? case $status in 0) # deferred restore refused - do it the slow way: return 0 ;; 1) # defer honored echo "... has been deferred" return 1 ;; *) cleanup $status ;; esac } # Delete files on DELETE_LIST do_delete() { [ "$DELETE_LIST" ] || return 0 #echo "Deleting files that no longer belong on the system:" : >$TMPDEL echo "$DELETE_LIST\c" | sed 's/^\.//' | \ while read file; do #echo "\t$file" if [ -d "$file" ]; then # directory, delete later echo $file >>$TMPDEL else # other file rm -f $file fi done # now deal with the directories, reverse-sorted so that deletions # are done going down the tree - sub-directories before directories cat $TMPDEL | sort -r | while read file; do if [ `ls -A $file | wc -c` -eq 0 ]; then # delete directory if empty rmdir $file > /dev/null 2>&1 fi done } # # Routine called before updates so that copies of existing special # (user-configurable) files can be made before overlaying new versions. # do_copy() { [ "$RENAME_OLD_LIST" ] || [ "$RENAME_NEW_LIST" ] || return 0 echo "Saving copies of precious files:" echo "$RENAME_OLD_LIST""$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do savefile="$file.old.admn" chmod +w $savefile >/dev/null 2>&1; rm -f $savefile echo "\t\"$file\" => \"$savefile\"" echo "$file" | backup -iqf $COPYTEMP mv $file $savefile > /dev/null 2>&1 /etc/restore -xqf $COPYTEMP done return 0 } # # Routine called after the restore so that copies of existing special # (user-configurable) files can be swapped back into place. # do_recopy() { [ "$RENAME_NEW_LIST" ] || return 0 echo "Putting back some of the precious files:" echo "$RENAME_NEW_LIST\c" | sed 's/^\.//' | \ while read file; do # accept the small window where the original file does # not exist (since mv within the same directory is # very unlikely to fail) echo "\t\"$file\" => \"$file.new.admn\" and then" echo "\t\t\"$file.old.admn\" => \"$file\"" cp $file "$file.new.admn" mv "$file.old.admn" "$file" > /dev/null 2>&1 done } # Initialization routine initialize() { RESTLIST=$1 SAVLIST=$1 DEV=$2 LINKS=/usr/lpp/admn/inst_updt/relink RELINK=/usr/lpp/admn/inst_updt.save/relink COPYTEMP=/usr/lpp/admn/inst_updt/tmpcopy TMPSAV=/usr/lpp/admn/inst_updt/tmpsav TMPDEL=/usr/lpp/admn/inst_updt/tmpdel INUSAVEFILE=/usr/lpp/admn/inst_updt.save } # Routine to cleanup temporary files and exit cleanup() { if [ -s "$LINKS" ]; then # save recovery information mv "$LINKS" "$RELINK" chmod +x $RELINK fi rm -f "$COPYTEMP" rm -f "$TMPSAV" exit ${1:-0} } # # Main # LDIR=/usr/lpp/admn/inst_updt if [ "$INUREST" = "deferred" ]; then echo "Resuming the update script for admn ..." else echo "Starting the update script for admn ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_special # take any special actions required do_active_files do_unflatten do_copy do_delete do_restore if [ $? -eq 1 ]; then echo "... update script completion deferred" cleanup 1 fi fi do_make_symlinks do_recopy echo "... update script complete" cleanup $ECODE # end of update script e script for admn ..." else echo "Starting the update script for admn ..." fi initialize "$1" "$2" manifest if [ "$INUREST" != "deferred" ]; then do_save_symlinks do_save # save all the files to be modified do_speci./usr/lpp/admn/prereq0000666000000200000020000000004705374315236014350 0ustar00binbin00000000000000oscrit admn r v=01 r=30 l=13 o >13 O5!O*خ*Th**@&A+(@@Oa done return 0 } do_make_symlinks() # # Update symbolic links defined by $SYMLINK_LIST # { [ "$SYMLINK_LIST" ] || return 0 echo "Updating symbolic links:" echo "$SYMLINK_LIST\c" | sed 's/^\.//' | \ while read symlink new_target fstore owner group; do echo "\t$symlink \c" if [ "" != "$new_target" ] then echo "-> \"$new_target\"" ln -s $new_target $symlink eval "`set_attributes $symlink $fstore $owner $group`" else echo "... deleted" fi done return 0 } # # Handle theextp_vrl/ 737254066 2 2 100666 16 ` 01 30 0013 0000 man_vrl/ 737254089 2 2 100666 16 ` 01 30 0013 0000 adst_vrl/ 737254114 2 2 100666 16 ` 01 30 0013 0000 ibm-iaa_vrl/ 737254152 2 2 100666 16 ` 01 30 0013 0000 ate_vrl/ 737254185 2 2 100666 16 ` 01 30 0013 0000 gsl_vrl/ 737254221 2 2 100666 16 ` 01 30 0013 0000 mcc_vrl/ 737254269 2 2 100666 16 ` 01 30 0013 0000 tfs_vrl/ 737254308 2 2 100666 16 ` 01 30 0013 0000 NKS" " kꄯ++ᯄ- ./usr/sys/inst_updt/special kQ6A++ᯄ-./usr/lpp/extpu kT3A++ᯄ-./usr/lpp/manu k45A+ᯄ-ᯄ-./usr/lpp/adstu k:A+--./usr/lpp/adst/inst_updtal k 9A+--./usr/lpp/ibm-iaat_updt kP8A +--./usr/lpp/ibm-iaa/inst_updt k>QA!+--./usr/lpp/ibm-iaa/lpp.loct kqUA++⯄-./usr/lpp/ateia kڹsAT+⯄-⯄-./usr/lpp/gslia k7pAS+--./usr/lpp/gsl/inst_updt kroA++㯄-./usr/lpp/mccin k$}A++㯄-./usr/lpp/tfsin k(0m.;++㯄-./usr/bin/ffinu+ th"Ph@.text .datah@h@th@.bss܁@܁@h"ÐUSVWh|@/8 V@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tPh@hG t:+'4h@fV*tƃ>uCÃFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u ܁@[C;t@'+[É=t@1uËt@t@L$ ܁@+fUS+;t@}4܁@C;t@|t@[ÐUSVW+;t@}phVyt } |BV܁@@@PU2t%܁@@@Pz܁@@fpC;t@|_^[U=x@u1@x@@Ð SVWt$ \$D$ i u+< u+1 @D @I; @D|$ D$$;D$ |ǃ t CF D$ ;D$$}>u_^[ É0ET@RU RP^]-@ P-@:jU SVWEE=@E=@kLi|M;tf;Eu_^[GNjǙ=@ u +Fƃ|+E}8~hN@h|@h衘kLi|M땃} u+_^[Ë_^[ÐUSr@0@E (b@'b@@ <@4@<*bh(@ϵh@u u$ ؃Ãa| $@}%<@륀 <@뜀 <@듀 4@늡\@D*b5\@g^8*b u5\@5@4*bH\@l@5\@%^h@ u5\@5@X4*b\@@5\@]|@ u5\@5@4*bh@5\@, }5\@5@4*b؂@P@ 4@4*b5\@X uNhS <@\@@= 4@15@5(b5@^ d@;E|5@5(b5@5 d@M 4n4@ tJ5x@5t@5p@5d@h@5`@5\@5X@5@h@~h蝕[fUSVWhhh@6 t&uV th@W  u]-'bh@S膶 }5'b5(@:@%` @  u5'b5@@hhDh)bS% }+_^[hh(bh5)b, }+_^[8(b(b@(b'b0*bP诎8@8@f@f(bh+P腎8@8@f@fT@f(bf;T@t(bP @hS'b }5'b5X@(bPn(b u 5(b5p@h|@軴 +_^[á(b(b (b#(b(bEPm (b u 5(b5@h|@` +_^[á(b (b (b# (b(b +_^[F=X@u5@+_^[Ã=`@~R($Ph 5\@5H*b& =@*bt5(bgrX@+<*bP5@O4@ t-=@*bt5@*5@5@_^[fUSVWVQf(bf;T@f5@35@sC5@sC5@s C 5@slC5@sXC5@sDC5@s0C5@s C 5@s$C$5@C(P~fC(5@C*PgfC*5@s,RC,5@s0;C05@s4$C45@C8P fC85@CpPfC:{$CEG'b;t35@'b-'b'b4@ t5'b5(bss$h@ ~}~='b~;} 'b;E~5@/E+ǣx@t@'b-'bp@d@8@@*b +=@}*kp@ PjP*bD@ uKE+ǣx@t@50@"h@50@(b@*bkt@ PiH*bL@ u&=@*bu5P*bk>kx@PWiL*b@@ u4=@*bu5P*bj5H*bj4 +@`@\@X@_^[ÉU$@ t@}fEfEf fEm]mEt@@ x@}fEfEf fEm]mEx@@ p@}fEfEf fEm]mEܣp@@=@~50@h|@h軍ÐUSVW+EE;'bfEE;'bff(bf;T@75@Pf5@CPfC5@CPqfC5@CPZfC5@sC5@CP/fC5@sC5@szC5@sfC5@sRC5@s >C 5@s$*C$5@s(C(+ }5@tLDLGǃ |F t7t2%@u SVSV t SVD](b='bÉEEE;'bMEE;'b_^[ÉUS] =@*btD t CPsuh@5(buh&@5(by D@ [áD@M tD@KHD@fKfHD@ X@X@;p@~5H@5p@[UDSVW}  Q%@ 8+ۃ }DLDCà |wG tSh@hud ,@,@8u$,@,@@,@f@H ,@f@HGK tJE~Ƌ ~$E@EuuEE+ ܁ƀ+4|t(;5(b~(b+(bPtu@ Cà } Ń}u }u}tuuuwu__^[fUL@ML@M HL@MHL@ \@\@;t@~5`@5t@ U@@M@@MH@@MH@@MH @@M H@@`@`@;x@~5x@5x@ ÉUSVW}]u hUQh5@x 'b'b'bph@W'bP @@;d@~5@5d@ _^[ÐUSVu +ۃ=4*bu ^[Ã=8*bt5D*bP58*b(@+F= @P t+؃=h@t5l@P5h@(@+F= @P t+؃=|@t5@P5|@(@+F= @Pl t+؃=P@tF;P@~+4@ tu  t+;4*b^[fVWt$ |$T$ƒ+u ;_^ƒ-uǍ E+;_^;_^ÉUSVWH*bL@+;5\@}]f5 (bL@pA  (b+CEL@0S,؋EL@;x|FƃL@ ;5\@|_^[ÐUSVW]u ;f(bf;T@t5@W ^VS5.@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ VS50@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uCȋ_^[;='b~W5@ h@hWV ,@,@xt ,@8u+,@8,@ph@CP,@P CPVWg Cȋ_^[ÐUSP*bD@=@*bh4@50@s(bf5(bhP SPh6@PhP Pp+;X@}KhPD@0 5D@D@0P CÃD@ ;X@|4@ ~+;@}tfhUQhS 'b='btE'b8t;'bPP'bp h'b0P C;@|[USVW]u };Sg=<@uh@@Q_^[<@ tVhB@0<@ twhF@<@ t<GPE?uGPhJ@ڢuhN@ȢhT@転_^[fU SVWu ]+<@ t5@VOV@Ζf}t+h@uG LP 2~5@h2h@hS ,@=,@t ,@8u<*b_^[h@,@PǍ LP ,@fxHt'hX@Ǎ LPGǡ,@X8 ~=hZ@Vh@Ǎ LPV _^[ÉUSVd*bfE;Cu^[à á`*bk d*b;wOuP u \@^[Ã=`*b2}ECh6S `*b^[fUSVL*b@@+;5`@f@@k (b @+'b@@xt5hS@@ph@@0S @@xt5heS@@ph@@0S] @@x t5h%S@@p Fh@@0S Fƃ@@;5`@^[USVW}+?E tt?ta'b;(b~(b)'b(b'bP7u } XhjS7hu Sl +h=S7dhu S? FƁ@_^[f|$u (b(bÃ|$u(bE(bá(bÐUSVW(bmhV5'b\ 5(bu 5'b  | }5H@SWu5@4@ tSƙ=(bPVh^@_^[ÉUS=(b} =(bua(b(bP5(b5'b2  |(b;t S5H@5(b5@h|@p(b(b-(b(b[ÉUSVW++hhlT*bH@ u5@+_^[Éh~@C uE+P+E tQuB V5 @뻋H@H@0G~58@hA댸_^[ÉT$ T*b; H@s;uÃ; H@r+ÉUu u5P@PÉU5'b5(bh@h|@&u,u(u$u uuuuu uh|@ÐUu,u(u$u uuuuu u(hzfD$L$@+AÐUSV++;5@}\fhUQhVD 'b='bt-'b8t#'b0) tC 'bF;5@|^[ÐVWX@+D$k P*b;D$ u _^f=@;|$u+_^k P*b;D$ u _^k P*b;D$ ~|$_^fUSVW]fS~ t;s~ t鐀?tu W uC_^[hWG+_^[ÐUS];u+[u 3h uC[Ã[ÐU SVW]S& h @Cp# u C ECC ECsCCs븋CxtP{Cfs>uGF67 t̓ǃ?uC_^[+_^[USVWh @u u+_^[hsR uV@M+_^[É3E CECu DRC uSSVM+_^[u RC u$s SSSVL+_^[ËEWQC u/s`Ss USSLSVL+_^[WQC u:s!SsSs SSSV9L+_^[ËCC@CC@_^[ÉU,SVWEpX  @^E EE}EEusE0=E؃uEEGu؍EP[VE܃~)EE;E}!CMEL ԈE;E|EԉE}E}}+_^[Ã} E0r<E؃uEEGu؍EPUE܃~)EE;E}!CMEL ԈE;E|EԉE}}*u_E0;E؃uEEu؍EPSUE܃uEԉE}} t}u )} t} t EEE E% uE @EFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ud@_^[Ã}u%h @ d@PEPD u @ d@EEh@}:t0}tuuuu_ =`@t/u6h$ @hh=h> @3Ph|@u}t @v @ d@ u+K @ d@ u+2 @ d@ @D,b,bu @= @ @ d@ ud@ @?_^[Ã}tC S讕؃}uhSEP uE}tm @ d@ u+K @ d@ u+2 @ d@ @D,b,bu}: @ d@ t! @ d@d@\@d@d@;E|x=`@t[h|@6ph|@hJ @h)h=hl @3Poh|@uh|@h t @?_^[Ëd@d@\@ @5= @ @ d@ u @d@\@E_^[UxS+ۋE tE tE tShxEPu薐 }[Ëà u}u E f@4 E f@4u EPL[ÉUxhhxEPu }ËE f@4u EPfUSV] uFCfF\fC0fF^fC2fF fC8fFfC:fFfCPvfC6fK>@+^[ÐWL$ |$ff% tf H%0=uf% f#%0=uf% f_ÐUSVW%@ }tE8u+_^[Ë]CÀ;u;ErXuƃ? @CÀ8t8= @hu u3GNJ @>~ۋEhu uEE8tE_^[+_^[ÉUE,bE,bEm EPuÐU SVW=,bE +EE;<ǍEEEM+EEEE]E +Nj ;]s/uS,bE u)}uS̃}};uv_Vu,bE uV}uփ}~0;]uV}uS }]VS+b+;]uGE+EM +M;|u EPEE uuEES)}uVS )}u _^[fVW,bD$t$ |$$FGD$|$u_^ÃVW,bD$T$$t$(|$,D$ BGFL$ D$|$u_^ÃVW|$T$t$T$fB8tBF  t }D$_^fUSVW}u,bE u+_^[u S|4 u+_^[u V' u ,b Gǣ,b_^[WL$ T$fG t:u t_ËB8u+_ÐWT$ |$!A t:u u G uً+D$_ÐUS] C{}SEP?[ËM[fW6ÐHÐsnHÐ!ZHøBHÐ$.HÐUSVWu} hVG |;u_^[WGWhVF }=H@u H@ _^[fUS] Suh|@c [ÐUS]Su uI [fU$SV]ufE]]S\3EVu EP ^[ÉfU@SVWu ]EEEu,b}u _^[Í@;@u.E8E%uE@%tpEEfE8t]E%uE@%tDE}u+&E @D,b +,bEE u_^[ËE%mEE0|E9EE$?uV"E'_^[Í@;@t   t Eظ@@PVEP Eأ,b u,b5,b]@ t@A C% t{ tW@;@uC{} S S+,bu,b,b,bE܃t:Eܣ,b u,b5,b袈@ t@A E},b,b@;@uSu* Su0;E_^[Ã}%u7%C% t{ tW@;@uC{} S S*,bu,b,b,bE;EtH,b,b@;@uSu) Su0;E_^[Ã}%F*u EFEEfkE EԃЉEFEԃ0|}9 u׃}$u>t5V[E |%}tEEEȋA ,b}|}tE_^[Ã}tE_^[ø_^[Vt$fF,b u,b@ t@A t%uLFnu+^+k ЋF0|9~$uFnu^ø^ÉU@SVWu] DžDžDžDžDžDžÃX| |@ ;$@tu*Dž DžDž+_^[F% t~ t>F~} Vy,bu,b,b,bt upEF% t~ t>F~} V,bu,b,b,bi0uzDžEF% t~ t>F~} Vg,bu,b,b,bxt XuzDžEF% t~ t>F~} V,bu,b,b,b@;@ut@ ho*0| 9~@,b ,b@ t@A% 0| 9 t0=,b u,b@ t@A  t7W+ȉ;9}t!u@;@u&;h TDžF% t~ t>F~} V,bu,b,b,b ;i t",bVP F% t~ t>F~} V,bu,b,b,b|Dž.et E>1 GF% t~ t>F~} VS,bu,b,b,b0| 9~+t -GF% t~ t>F~} V,bu,b,b,bE}| }_RPݝt݅ݝ}lu6}tE E ȋAH}tE E ȋA݅tt؉}lu*}tE E ȋAZ}hu,}tE E ȋAff(}tE E ȋA;IF% t~ t>F~} V,bu,b,b,bNF% t~ t>F~} VJ,bu,b,b,bF;F% t~ t>F~} V,bu,b,b,b}}lutt}tE E ȋAHKt }tE E ȋAQLV[ ;F% t~ t>F~} V,bu,b,b,b}}lutt}tE E ȋAHKt }tE E ȋASLV ;F% t~ t>F~} V),bu,b,b,b}}lutt}tE E ȋAHKt }tE E ȋAt+,b,bVu _^[Ë_^[ÐUSVW]u }+_^[+}+EE ƃt_t&tUt tukt4}uE}tE E EȋAE<}uE}tE E EȋAEE+_^[Ãctwu}uEƃ;t*]ZE@% t Ex ta@;@u&E@x} u}E u,bu,b,b,bE#uu;E  tK@;@t E  t E uW/E }+_^[ËEE}E@% t Ex ta@;@u&E@x} umE u|,bu,b,b,bEE,b u,b5,b^r@ t@A  tK@;@t E  t E uWX.E }+_^[ËEE}wfE@% t Ex ta@;@u&E@x} u9E uH,bu,b,b,bE tK@;@t E  t E uW^-E }+_^[ËEE}}E@% t Ex ta@;@u&E@x} uAE uP,bu,b,b,bEuu ;E t EEME}6E@% t Ex ta@;@u&E@x} uqE u,bu,b,b,bEE,b u,b5,bbo@ t@A  t EEME}E@% t Ex ta@;@u&E@x} u}E u,bu,b,b,bEt' t EEME}Q+_^[Ãu$;}uE;Eu}u _^[+_^[Ã}tN}tH,b,b@;@uuuuuu _^[ t$ƃtt t u E_^[ÐUSVW]u ES@E=l@t>E;l@~VEP5h@%h@ u4l@+_^[ËEP#h@ u+_^[áh@h@E;l@~El@C^u h@C]bEE h@]C-SC8GC]8h@EEE h@-],b u,b5,bil@ @A }+_^[ËEE h@<C @DE@;@t C  tCE@@PCPEPGj }+_^[ËE주,b u,b5,bk@ @A }+_^[ËEE h@C{} S(,bu,b,b,bENC% t{ t>C{} S,bu,b,b,bEaC% t{ t>C{} SP,bu,b,b,bENu[Ã,bSu ,bSu ,bSu +[U(SVW]+uEE=p@p@p@P,b5p@n,b=,bt =,b u+_^[ËEE;p@}fE,bEE܋E;p@|;%t8 u+# @D,b +,b u+_^[ElC+k MЍ<CE0|}9 u*uEC*u ECE;}~ }u}E;p@p@p@P5,b,b5p@5,b,b=,bt =,b up@+_^[ËEE;p@}E,bEE܋E;p@|0| 9CEfftftftfuECEC}}t.E,bIF[uC]tCCff=%|7f=E|!ff f=3$@ff E,bE؃}tldM؈FE,bfFC[u;t C]uE,bE؃}twsM؈FA;t-;-u;sr ;sw_^[à ;;u_^[Ãθ_^[Ã;t3;-u;sr;sw _^[à ;;u _^[Ãȋ_^[ÐUXSVWEEEEEEȉEEEEEEã,b u,b@ t@A ufft fuEEEfÃ.u}t EECÃ0|EÃ9~;EEEÃ0u E;EuEEȃ;EvEEĈEE뙃}tE;Eu EE0EȋM+ȉMuEPEPO ?u)EEE}u @_^[E_^[ËE+E+EXÃet ÃEE;EE,b u,b@ t@A u@E+t E-ucE@,b uP,b@ t@A t9uEu=H@"uE-u+ EEX|:E4~NH@"}u @_^[@_^[øX++E@D~H@"x@_^[ }+~ƃE t%E4@EP M M\@ƃ8Et&E@PEPM Ml@%Et&E@PEPM M|@ VE܉EE+} +ljE +EȋEMU ‰EMEE+| +EEܿeE%EuE܋M  EEEM EE_^[ÉT$|$uB t;Bw;Bu zuÃ:uËL$BD$U SVWu~~Ë @D;F~V_^[Í@;@uF_^[Ã>u  u+ @|@ u|@F+_^[á@8f:_:_GE taEu;x:: |@FG _^[|@FG _^[ËEuJx:rb: w]|@FO+OW+AO+D_^[|@FO+D_^[Ë? |@fN _^[ÐUSVW]E E{u SC u(C% tfKH@ _^[CD tZEC u+0C @D,b @I;,bE@tu/|@+_^[fK _^[fK _^[+C;E<{u"C u+C @|@@@PsEPW E }|@fK _^[ËE|@E_^[ËC +C+EPECPCP ChEC{u+>C u+0C @D,b @I;,bE@tu2t|@fK _^[|@C+_^[ÉC;E}OC +C+CPCCPCP9 E@tufK_^[fK _^[ËEC멃;u  u+ @|@@@P3EP?V E }|@fK _^[ËEE)CE|@E_^[Ã{tfK fKC% tfcEC_^[ÐUSVW] }u _^[ÍuuVC t;Cwc;CuR{uL{u+>C u+0C @D,b @I;,b _^[Ë@tut _^[ÿC;v _^[);fǃ ~ F E u+:E u+.E @D,b @I;,b);{E_^[ÉUSQRWV33ҋMu ~U%SRT$\$Ѓ׸u-@tں Hs@u^V^_ZY[]ÐUSQRWV333ҋu^Fu VNSPRQڋD$ ؃L$D$ D$֋ϸ|HӃsuVN^_ZY[]ÐUSQRWV333ҋu^~M ǃȻUSQRWV333ҋu^VM ظ|Hs uV^_ZY[]U5H@US]hh,bbM }7hX@hhh@FPh|@舴hc0=P@uh@SдP@5P@K0=-bt5-b -b*[fU5H@uÐU0SV] S/=P@u+^[u@PEPuD 5P@hh-b| tuh-b~Ph-bE t‹E0\@PEPE0 E0MEPEP E0E^[+^[US]5H@S [fUSVu ]V1=P@u+^[f5P@hP | tJPPPE tSEPP tE^[+^[ÐU=P@t5P@}P@=-bt5-b -b.AfUuhP;{ u+ÍPPP ÉT$:t:t  tB u  tBÐT$:t;t :tB:t :tBfT$:t;t /tBfU5H@USV],b u5hh,bI }h@h|@h,=P@uh@S>P@ u+^[Ã=-btL5>b5-b5-b$ 5-bp u+^[ VT u^[ÍPPP tB}5>b  _V N^[5P@hP$y u+^[ÍPPP  u+^[fftfeV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uaV_ >b @uLV@ >bh,bh@hP2 t PV >b5>b@PA V w^[@uyh,bh@hP t+^[ËPPPPZ tt @P Vq  ^[USVW} Efftf+!EV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u1S( VW tE_^[+_^[Ë@@uNh,bWhP t*S VW' tE_^[+_^[Ë@EV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ S V@PA tE_^[+_^[Ë@@u4h,bWhP E_^[Ë@EV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ E_^[ËEV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u _^[+_^[U SVW} EfftfV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u0SVu* t _^[+_^[ËE@@udPP`SVu t+h,b3hP t _^[+_^[StV@P tC;Eu _^[+_^[ËE@@uZPPh @u7 tbh,b3hP tC_^[Ë@P2;Eu"_^[ËC;Eu _^[+_^[ÐUSh @u tC[ø[U Sh-bh-bEPEP5-b5T@h@h,b0( t -b=T@t5T@uET@E-b[fU Sh-bh-bEPEPh@h,b# t -b=T@t5T@ ET@E-b[fUSVW] EPEPuPuh@h,b, t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[ÐU$SVW] uh@EP蟼 EPEPEPPEPh@h,bH+ t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[fUSV]u ue u+^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$^[USVWu uhH>b;w H>bE H>b E @H>b+ >bS؉$>bS:u u+_^[h EPS; ]C:t u+_^[ |  tǣ(>b:u u+_^[h EPS ]C:t u+_^[ |  tǣ,>b<>bS؉@>bS؉D>bS$>b;t ,tC;tC0>b<>b4>bL@8>bS/u*ChEPS ;]u]=4>bS;u C8>b >b_^[ÉUS>b t3S[ u>b[ÐUSVhu@PuS>bF5>b^[ÐUS]=LNbtNLNbp8LNbp(LNbp LNbp$5LNbh(QLNbLNbEs@P/MAsLNbpLNbEs@PMAsLNbpLNbEs a@PMA s LNbp LNbEs$+@PMA$s$LNbp$LLNb[ÐUSVE5>b EVӋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u ^[Ëv ?+^[ÐUSVWu]E} tE  |$~+_^[E,b u,b@ t@A  uLE,b u",b@ t@A t CEϋEtu ECE u+}0t Cxt CXuE,b u,b@ t@A  E,b u,b@ t@A  tEBE,b u,b@ t@A  t E E E;|+_^[ÃuJ}0uDC,b u4,b@ t@A% tCxt CXu EE,b u,b@ t@A  tEBE,b u,b@ t@A  t E E ؋ +ECE,b ,b@ t@A E,b u,b@ t@A  tEBE,b u,b@ t@A  t E E E;?} tE }t_^[Ë_^[ÉU$Su u[EE E܉EfEEPSXEuu +[USVWEh @h @ u _^[É}WhhPNbd PNb5PObf:t t;tFC܋EEVЍ5POb;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ EWh}u _^[ÍPNbEuLEu u +_^[ÐUSVu++ۃ fE Cà ~V u+^[É>t,f uFVmE V +^[ÐD$H@ÉU SVWu }]u u+S u+8 u+- @D,b @I;,b,b|,b+E lFE@;@t   t,b@@PSh,b6 ~,b+s\@;@t   t,b@@PSh,bj6 ~ ,b+@;@t   t,b@@PSh,b6 ~,b+Ph(@u(@;p@  t(@D@?ME FC  t ; ;uv u+E_^[ÐUSVu ]s3h@VEC tsh@V* ss sh@V{tsh@V s$s h@VF ^[ÉUS]VӍ5XQb;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u PPbTPb[Ã=PPbt&SPPbTPbShXQb[ÉUSPPb tC{t s{t s;t 3S}[ uPPbTPb[Ã=TPbtFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u2uh@h8hh4@|Ph|@ޓ _^[Ë  hEE G} ] f t uC #(uvhECh,PS h,EPS t|h)EPS taE PPbH EPPb.h<@SW t#tVu S hB@S) _^[hF@h|@蜒uhf@h|@臒 _^[fUSVW]C t tEPS  u+_^[;u E OG t t+@E@PHM uSE 0>e EM G_^[USEPEPuPuhn@hXPb t+[ËE[fWL$f t|$ :u_Gǀ?uA+_fUhhdRb) }7h@hRhh@yPh|@!h dSbVbE \RbEXRbE`Rb=`Rbtv=XRbt2=\Rbu)EP5`Rb5XRbuh@ t@EÃ=\Rbt2=XRbu)EP5`Rb5\Rbuh@[ tEuÐU0SVWVbVbMdSb ;Vbs8h@hThh@xPh|@Vb+_^[ËEEuEEPEPuuh@hdRb E؃tVb+_^[Í=dSbVb; MEԉMVЋEԋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u;uh(@hShhR@xwPh|@躎 Vb+_^[ÃǡVb;]E E t uC }#q(CÐ t uCh,S،E u hZ@h|@Vb+_^[;t =\RbuE:F t F u+PS5\Rb躤 uE]C t uCh,S<E u h@h|@eVb+_^[;t =XRbuE:F t F u+PS5XRb uE]C t uCh)S蠋E u h@h|@ɌVb+_^[;t =`RbuE:F t F u+PS5`Rb肣 uE]C}uou:Vb_^[h@S{ t#tO tS tuVb_^[ t h@S( [uVb+_^[ÉWL$f t|$ :u_Gǀ?uA+_fUSVu[] fVSuz u3,t 3 u ^[,t   uCCÀ;u+^[ÐU SVW5@+ۃf tt#t3uTtAuuP ;uVP &VuP VVP EPEPP[PPuhdRb u0uu Mu'E8t_^[Ãt+_^[CÃE_^[fVW|$T$ t$BF  tB.BG  t_^ÐUSVWf]+ u5+ tf;u tw_^[ tg+_^[U=@}3hhH@@ }+YbYb$ u+hVbhVb=VbÉUS=YbuGhhWb5@z Yb=Ybt YbYbYbYbWb CÃ=YbtYbYb;+[Ë+Yb~+[Á|+YbYb5YbYbWbPhWbD +YbPYbWbP5@衑 Yb+Yb;Ybt YbYb%=YbtYbYb;+[Ë+Yb@PYbWbPhVb YbYb=Yb| Yb[ÉU=@|A5@hhR@߉@ }+YbYb@fU=@|5@@@á@ÉUSVu ]+CC+CCC ffCfCf V]fVuCVgCVYC tGVGCV9CV+ tVfCs MfC^[ÉT$ u+Ð:t t  tB:u B+ÐUSVW]=H@5@;EVЋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u F_^[Ã;=+_^[ÉSVW|$(\$ t$$\$ t u +_^[D$$f|$ ~lD$ D$ ~ CF  u+8 u+- @D,b @I;,bD$ D$ D$;|$}+D$;}D$_^[ÐUSVW}]u WVSi# _^[ÐU,uTÉUS]ShhCPd CCfcC% tfc[fÐUSVW] +Cu{ u);Cu{ t CD   t S+ u}u _^[ËC EEM+ȋ Su_^[WhuuME t E+E){;C +E{}+CM;~ S}t*CD tS+u _^[Ë_^[}N_^[ÐUSVW} t}u _^[uu  t@ t@~ _^[fEPu  t_^[ËExhu`Euuuu5@5@uu uU$؃uu^ 5@$_^[ÐU SVWu}+ۋEEE E+EE+EEuuEPPEP0Phw`G`@ t _^[Ã}t u uIEPA t/E$EMQ&M u6 u[E Mu6u E E@E(MuE$0u EM$ E@M$EPPw`G`@P _^[ÐUSu(u$u uuuuu u4$ t[u(u$u uuuuu uj$[U0SVWu}+EEEE EEEEEuuEP(PEPPhw`G`@ t _^[Ã}t u' uIEP t/E$EЋMQsMЉ u6 u[E Mu6uX E E@E(MuE$0u, EM$ E@M$EP(Pw`G`@P _^[ÉUSVW} t }t}u _^[u7u * t@ t@~ _^[ÐEPu4 t_^[ËExhuHEu$u uu5@5@uuuu uU,؃uux5@>z_^[fU(SVWu$}+ۋEEE EEEEE+EE+EEu uEPPEPܽPhw`G`@ t _^[Ã}t u uIEPM t/E,E؋MQ2M؉ u6 u[E(Mu6u E E@E0MuE,0u EM, E@M,EPPw`G`@P _^[ÐUSu0u,u(u$u uuuuu u6, t[u0u,u(u$u uuu up$[ÉU0SVWu$}+EEEE EEEEEEEEEu uEP(PEPPhw`G`@ t _^[Ã}t u uIEP t/E,EЋMQkMЉ u6 u[E(Mu6uP E E@E0MuE,0u$ EM, E@M,EP(Pw`G`@P _^[ÉUSVW+++ 5@h@E0 urEE 0EE E$0E$E(u(u$u uuuuVSu u ,S+j_^[fUuuu +AÐUSVW} t}u _^[uuu h t@ t@ }t}u _^[fEPud t_^[ËExhuEuu5@5@uuuu uU$؃uu5@t _^[ÐUSVWu}$+ۋEEE EEEEEEEu uEPhPEPܽPhv`F`@ t _^[Ã}t u  uEP u u)E(Mu7u E E@EPhPv`F`@P _^[U,SVWu}$+EEEE EEEEEEEu uEP(PEPPhv`F`@ t _^[Ã}t u) uEP u u)E(Mu7u E E@EP(Pv`F`@P _^[ÐU8SVW+}tu课 u _^[u u* t+_^[YbEEEE}=Zbt5+t)EPu tu tE_^[Ãu׍EPEP u }uE_^[ ug} uaE_^[û?fEPEPEPWEPEPJ tutE_^[EGǃ=Zbtu}$EPuu؍EP}E uE_^[Ã}u u- E M+_^[fUEPuZUSV}u Yb EEVS;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ucEPEPs\ uEtfCdf;Et  tC\u'+E ^[Ë +^[ÉUSVWuYbNfhoXZfFhFPLhhhL ؃uE +_^[hVS }'hS2 SIE +_^[hS S"_^[ÐUSVW}=Zbu+_^[ÍYbOf5Zb{YfGhGP"LhhhK ؃uZbE +_^[H@hWS Sj tu#=H@CtZbE +_^[ø_^[ÐUSVZbE视E EEEEhhEP5H@5D@hhuC uE+^[5P@5L@hZbPEPPhSC SCPuu u!=Zbt ^[ËE +^[5@6E^[ÐUSVWu E>u }~hhEP5H@5D@6huC uE+_^[5P@5L@uHPuPhSC SCPu uCE8u _^[Ã>u}|>u5@FE_^[à u>uE +_^[5@ZbE_^[fU=Zbtu EP u+u uEPÉU(SVWuE+hl9 u7h`@h-hh@VPh|@m+_^[ËE{LfCHEf@fCJhCPP~HEf@fCXC\} uChh@hC\P5X@5T@} uPhCHP@ C` uS+_^[hhs\ fEEfEhEPGhEPs\ tS+_^[ÍEPEPs\ u fEfCdSW+_^[uCPwYbYb_^[USVWuEh@hEP5X@5T@hhFHP? tz5@5@hhPhhPhSC u/v`F`@Pv\F^`EF\Fh_^[SCPu_^[fZbU|SVW] u+_^[ÍEPdEMEP EPEPh$ u+_^[Í@MEEEPEPh }uEPhEP t uEPEMEEEPEPh1 uhEPhR +_^[fZb t;vlE؍E̍M+EMؖhEPh u3hEPh hEPh +_^[ÍEMhEPh!]hEPh& uhEPh[ +_^[ÍEP`EEPEPh hE}u}t;}| +E E+Nj t&;}+uhEPh} hEPh{ hEPh ;}} E+_^[+_^[VWT$ t$ t |?~H@_^ÃƍB <θ!+_^ÉWT$ uH@_Jy;s;r+_ÐWT$ uH@_Jy;s;r+_ÐVWT$ t$ t |?~H@_^ÃƍB <θ# _^É.úĻÃÐøøøøøzøbø J|$tT$ø*ËD$ |A <$$@+6/(! Uhhl@E PE PuJÉUhh@E PE PuJÉUE EEPuH tE DPu ÉUhE PE PuIfUh@u uJfUh@u uJfUE Pu tE Pu  tE Puj ÐUE Pum tE Pul fUE PuE tE Pu fUE PuUE tE Pu  tE Pu ÐUhE PuTGÉUE Pu thE Pu#G ÉUhh@E PE PuHÉUhu uIfUSV] uSV tCPV  tCPVAD  tC PV ^[ÐUSVu h|@Vuz |@ t ^[Ë^[Uhhdu uÉUhhdu ulÉUhhdu uhÉUhhdu u4ÉUu hxuu2Uu hxuuøøUSVW} t E  u+_^[ËE @0f:^:^F t]ǃu:E x:~:~ }F M}F M|ǃuBE x:~rQ:~ wL}tZN+NV+AN+MD.}t(N+MD6 _^[;}~ _^[Ë_^[ÉVW|$T$t$T$ t u_^f |)ƒ΃  u吃 |ۋƒD$_^USVWE% u E%_^[ËE%؋E%E%|#Ci@ƃ u |AFG0u |~FG |~Ci@ƃc_^[à u!|F=_^[Ã/|$~ |~Ck_@ƃ _^[;=h@| _^[Ë_^[US}u+[á@@Pu +[ËE[ÐVWD$|$ t D$  u+_^ËD$ @0 :V:VF t8ǃu"D$ @:Fr D$ @:F wD$kD$aUǃu1D$ @N+N+|t$D$$N+|t D$ 6 JD$;D$$ D$_^ø_^fUSVW]5H@t{u5H@E_^[Ã{u SI؃u5H@E_^[Ã;teC @;E rHE k C@;Ev6EM k KI|t 5H@EM k KID_^[É5H@@_^[uu S*b t?t 5H@_^[É5H@E_^[ÐUSVu] uVShZ/@ɦSh_3@軦Shd7@警Shi;@蟦Shn?@葦ShsC@胦Sƍ P'@PfhsC@hn?@hi;@hd7@h_3@hZ/@h~K@hH#@s u H#@^[Ëƍ P'@^[fUSVW]u |~+_^[VhxG@ޥ u&u H#@_^[ËÍ P'@_^[ uS _^[VK@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uSSg_^[CuRF@uGSSFPh thS S _^[DžGF  t"G@uGSVh9 PS% t+_^[S_^[ÐUHSVW] hu _^[ËE tD}tExuE@E}u担MH EHE$ȉH @@EЍEԉEE+ɈEǃt t4EEC  E@=uߋE@ u+8 u+- @D,b @I;,b;EMQ!Q Ah=Axu _^[Ë@H @EЍEԉEE+ɈECh u+8 u+- @D,b @I;,b +_^[fƃ ~EEЋC  uYEMQQA@D;uEp+_^[[@t _^[Ë_^[US] t+{t[;[ t[ sS[fT$ t;D$uD$ Bà ƒ8u+fUS@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[à Ã84+[fT$+ t;D$uËA ƒ8uÉT$ t;D$uBà ƒ8u+fUSVW+ۋCM (#@4 Vh0!@ |k f<8!@tk 44!@Cƃt tu-thK@ hK@ hK@5k f8!@Vh @2PVh0!@ G_^[ÉUSVW]} tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv  ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u6v1 u56Ek f8!@Ek N 4!@v  t26蹧v讧v uup_^[u[+_^[ÐU SVW} t E  u+_^[hu PPxP%P VK@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ thK@PhK@PN u5PhK@h@h|@/NhK@_^[+ߐVhP6 tQ t#tЍP謕ƄEuPS V_^[ÉU SVW}EhK@cE tE8u K@EWP uhB u0WCPh( PhS+_^[fEk $@E 3uh@PbE E8EMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tBuu u0WCPh Ph<S蟣+_^[ES臣W>_^[Wh@E u+_^[ua t uhK@a t uhK@WM_^[VW>_^[ÉUSVW]u }| t u+_^[Ã}fE\uFR:uJ u+8 u+- @D,b @I;,buF5 u+# @D,b +,b l u+_^[Ã}SfCF  ts\u CF :uJ u+8 u+- @D,b @I;,buC_^[USVuu h0!@ u+^[Ã}}SV觓^[uSVT u+^[Ë^[fU SVW+ۋfE(#@< t[Wh@\EWh0!@KE}t}uFuܐEuΐMȃF딃Ek (@EEk ,@ u)SE uEhK@h|@H+_^[Su衠E uhK@h|@tH+_^[ËEk f,@Ek M (@+E@E@E@EE(#@< Wh@<EWh0!@+E}t}uFuuu讏EEE=uuؑu艏EEE;FfEEhxG@u_^[À=Zbu =Zb u f=Zbt Zb fU$SVWEEVK@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uM@;|@tB+_^[hhu PHE }?hu PhK@h@h|@FhK@ _^[hhZbuyO t"hL@ uh_^[B tOh L@h|@EhuO Ph6L@h|@E Xu_^[Zb%u+EhhZbEP tL@k uH_^[ÍM@;|@t85x@j5|@\5@N5@@ZbÍP茚x@ÍEPu|@ÍEP^@5ZbK@=x@t=|@t=@t =@u'hDL@| uY_^[áZbS5x@u#M ;t'chLL@1 u_^[áZbES5|@uL ;t'hXL@ uÞ_^[S5@uL ;t'hdL@ u膞_^[ËZbS5@uXL ;t'hpL@f uC_^[hhu Ehhu E}|}|E;E~'-hL@ u؝_^[ËE)E}u_Zb u'hL@ u荝_^[huu\ ;Et'hL@q uN_^[Ë]S5Zbu#K ;t'chL@1 u_^[áZbh@Zbl@Zbp@ uuל_^[5h@V5x@q 5h@V5|@t 5h@V5@_ }uu肜_^[EbEkZbEVMk ZbIQMfAEkZbEVMk Zb QMfEE;Zb|ZbEE؋E+Ù=pM@PVZbP uț_^[U=x@uQ@;x@t5x@=|@uM@;|@t5|@辗=@uM@;@t5@虗=@uO@;@t5@t=Zbt5Zb]ZbQ@x@M@|@M@@O@@p@h@l@U SVWEEVL@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u8O@;t@t#5t@0O@t@d@+_^[hhuP@ }?huPhL@h@h|@=hL@_^[hhZbSJG thL@\_^[ tMhL@h|@=hu+PhM@h|@d= 4S_^[Zb%u+EhhZbEPr t(V5ZbZbV5ZbZbO@;t@t5t@褔ZbEPt@=t@u5O@t@d@hM@/S_^[áZbEEu5t@SE ;Et h M@Sȗ_^[áZbd@ t5d@V5t@g S蒗_^[ÉUSVuV贃V,M@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u>@;@u+^[5@&@@@@+^[VP3V.M@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ th4M@PhPPX@ tBh@P%@;@t5@@@+^[á@@h@PPh:M@h@h|@g9hFM@ ^[ÉUSVWu/t.u_^[hPM@FO u^M@ShZbhlM@hZb} t,E  t"u hZbfhnM@hZbTVhZbFZb_^[ÃVW|$T$t$;t,f | BF +D$ tD$_^+_^fUPSVWheu=H@|GH@;Y@}:H@8W@@;@uw +w ww7 5H@hW@V>O u t(Suhx hh2W@ha VlPVhI hh6W@h2 _^[ÉVWT$ t$ u_^ËfB8tBF  t_^fUSVW]sG u+@PC tGC  u_^[+_^[UuqfU SVWu] EEF% uH@ +_^[à ~#V>uE;Euz+_^[ÃF;^}FWh 6u]E tE+E})~>F +E~}+FM;~ V݋}u + jEE_^[VW|$T$ t$D$|$|BF ;u_^+_^ÐÐU$SVW}uH@+_^[hu7 }+_^[hEPW> VDl@u;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tW%H@+_^[E%u+EuEPfEuEPofEuEP[fEhZ uW蟏H@ +_^[CfEfC fCEPC P}h h/uVE tE@EPCP +}3D3FƁ|fEfEf t*uSW }SgWގ+_^[fEfEf t*uSW }S/W覎+_^[W薎H@_^[ÉUSVE tS谊 uEp tf6V蔊 uu腊^[ÉU4SVWEhEPu< tH@_^[uEPfEuuEuuEE u2EM+@EEuEM+@m؉E؋E؃P$ uH@ _^[fEfCECECECEC EC EC EE M8GE;}EEEE MЈL8GE;}E E̋E @;E}EE @MfA}hhu芌 Ehuut u؍CPuj: ;EtS谈H@_^[huu- Eؙ=Hl@PuCP E 8uE E 06>u+_^[U,SVW+hEPu9 tH@_^[uEPSfEuuEuuEuuEuuEE uE+EGE tGP uH@ _^[fEfCECEC EC ~ohhu֊ Ehuu WCPu8 ;tSH@ _^[huu| E xuE XE p6>u+_^[ÃD$ tD$ D$D$ D$D$D$ à VT$t$D$ t&ƒ tFD$D$ƃfL$f^ ÉVWD$ tt4uwtLsD$D$D$D$ D$D$ D$D$ t$|$HfD$fD$fD$fD$ t$|$)D$D$D$D$ D$D$ D$D$ t$|$D$_^fUSV]uE tt-uxtJ^[ËÍ+5Ll@Pu V ^[Ëà tGfFfEffEƃM܋à t#FEFEFEEƃM^[UW+E+҃}DuBƒ|E |$Pl@+_Ë3_ÉVW|$T$t$T$f |$BF  u |ۋBD$_^ÐWT$ L$+:uA8u_ÉUHSVW]h n uChl@hJhhl@Ph|@+^b H@^bE +5l@E E$+5l@E$E XE$P uChm@hJhh(m@-Ph|@o+^b H@^bjE$DTFLhEPE@ u?huu ufE EEMQ0MfAl@GwENFENE FHE$FP3E3EEEEE E̋EEhu vLF,PEPF,PQ  tuF,PF0PFD;}NEhhh }^b H@^b%EPh~f3օ _^[ t V迁 t W貁+_^[US]h`"h`"Suuuu ub [USVW]sDžTDžX~,vDWGPFLfE PWGP t W3@ P tuWU u F _^[WGPEvFPhuvL6;EtH@F$F _^[Ã} u}$u F _^[Í^bMEEEEhEP=l@L=l@ʸL DEMЖѹFPhhEPh@tqFTFXX@B|TX⋅T;E T;E uX;E$F _^[Ã=H@KH@F$F _^[Ë=l@L=l@ʸL#D fEEPEPhvPFTP6E}} =H@tɃ}}"=H@6H@F$F _^[Ã}FLNT;thuFTP\P| tP\PRPtmF PtP~ u>EP3@ P uF F$}t2EPW3@ P  t F F _^[VWD$ PD$r _^USVEXs,uVU ^[ÉfUSEXC0xt C,PC0PS}u}[ÐUu u7t&} tx5E E^b=4m@M+øÉNø6Ð"ÐÐÐUSu Puo' [ÐUSVW=<_b5^b= _bw=_bm@ _b]hhh(_bSD h_bSh _bSSCP<_bCxt SCP_b_^[U5<_bh(_bu E @P fÉ+ÐfU SfEEEEho4 MfAhhEP5m@5m@hhu E EEEEEE5m@5m@EPPEPPhSC t^bh^bSCPE u ^bSCPu~Ef@E[USV] uSV& t3CPV t"CPV tC PV^[+^[ÉUSVu ]VS thFPFPS^[+^[fUSVu ]VS u+^[ÍFPS^[USVu ]VS u+^[ÍF PS[ u+^[ËF tu8tvSV^[ÍFPS u+^[ÍFPS^[ø^[ÐUSVu ]VS u+^[Ë tu;t(FPS u+^[ÍFPS^[ÍFPS^[+^[ÐUSVu ]VSv t6FPSq t%~uhhm@F PFPSP^[+^[fUSVu ]FF;uRVS  tDFPS t3FPS t"F PS tFPS^[+^[ÉT$L$ |61$n@    AQfL$T$ƒt uAQÐUSVu ]C tu.t{u ^[VsBVs  CFt tu(tCFCF^[ËCF^[ËCFC F^[ÉÉU tu u<u uÉU tu uXu uÉUS];uu SCP[Ã;uu SC[Ã;u[+[ÉUS];uu SC[Ã;uu SCP[Ã;u[+[ÉUS] t t!uLtBE EEPSCP[ÍEPSC u+[ËE fMf[ø[+[ÐUS] t t!uLtBE EEPSCP[ÍEPSC u+[ËE fMf[ø[+[ÐUE EEPu5 u+ËE MfUE EEPu% u+ËE MfUS] t t,uatWE 8t+EEPSCP[ÍEPSC u+[Ã}u+M [ø[+[U tu u+ tu u+ tu u+fUSVWu] u _^[Ë+5pn@ v +Nj;ufEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMffEEhEPuli + EEȡn@ tEȊ@EҋEȊEӋEfMfn@ tEȊ@EҋEȊ@EӋEfMfHn@ tt?tU}EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HNEf@fE̋Ef@fE΋EȋM̉H-EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HE t+n@ tEEҊEEӍEfMfE+ ~n@ tutt-uftBbEE̊EE͊EEΊEEύEfMf>fEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMf]؉uEfEEhEPurg  ẺEn@ tE@EʋEEˋEfMfn@ tE@EʋE@EˋEfMfHn@ tt?tU}E@EċE@EŋE@EƋE@ENjEMĉHNEf@fEċEf@fEƋEMĉH-E@EċE@EŋE@EƋE@ENjEMĉHE+ t+n@ tE͈EʊËEˍEfMfE+ ~n@ tutt-uftBbE͈EĊËEŊEψEƊEΈEǍEfMf>fEfEfEfEƍEfMf"EψEĊEΈEŊE͈EƊËEǍEfMfE;EvẺEE̋M؍U̍򗥥EE;EE@؋E@fEfEfEf@fEEk MAMԇ񗥥GNjE@ @;ubEuE_^[fU$SVWh/u  tho@u _^[ho@ E u &o@Eh hTE uhBo@u _^[uQ@PC` u+_^[uSEu zhhP %Ffft(ftLft(fftTftlCuSRSuQuS4SuPu[WS SWP^uWSRWP:uWSRWvPC%CCFƀ>hDo@PE (`E_^[`hFo@u_^[ÉUSVW} u+_^[WO@P5^WVRh:V u C:uCPWQ_^[ÉUSVukO@P]uSQh_S) u+^[^[ÐUSVh_u u+^[CSO@Pd]SV0Qh.V u+^[^[ÉUSVh.u u+^[CSN@P\SVP^[fUS+E P_bIEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u P_b[Cà }FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tC } EP_b[US]t{u[s t5hhC@PT_ uS[+[+[ÐUSVW}]+L; }- +ÃPP_bPCP_bPX^ t_bCà } t[hEPCP\ E%u+n@n@ tCEEfEfn@ tCECEfEfCn@ tCECEfEfCn@ tCECEfEfCn@ tCECEfEfC+[fUSVWE m;]s}t } t+_^[SW u+_^[ËC+5Ho@EE}| ǃ_^[ÉUu)YfT$L$:uËA8u+ÉUSo@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[ÃÃ84+[fUSVu t u+^[V u VF^[SAJ^[ÉUSVWu}F u(F% tfNH@ _^[VWu _ F t _^[Ë_^[ÉUdPu u(ÉUS]SPSu u [ÉUSVW]E u+_^[ËE @+E fft*ftKfuV t  ? t  u!E t++_^[hWu: E }+_^[CfEfC tE rufC+CC }t!hhuY u+_^[Ë_^[USVWE +84@ƀ@;sC% u_^[à ;rG;}} <@u;}}8EPS@ tuh4@ _^[+_^[ÐUVW}E ME_^]ÐFYÐUSV] u^[Ã} uSȋ^[É@@PSEPT |DE ;Eu^[ u+# @D,b +,b t;u+^[ÐUSVW}t} u _^[ËE  uE+_^[á@0:^:^F tcuLE @:FE @:F }} _^[M I M_^[ËM_^[ÃuTE @N+N+|tP}} _^[M I M_^[N+|tËM_^[Ë6 _^[SVt$ u+^[+~ u+8 u+- @D,b @I;,b ^[ u+# @D,b +,bCÀ>{^[ÉUSVW]} C @;}k C@;EEk KI4~Ek KI<Ek KIEMVBR|PMUE u q@_^[hvsV shF@Put q@_^[ËE_^[ËEk KI_^[Íq@_^[fUSVW]fcC }}i{tcC uXs} }uhhCPT +)u C% u ~;C+; ;){+_^[C% t Cfcuu CPT CuC% tYSJC% tCfcC tuu CP-T &uu CPT H@ u _^[+_^[USVW]} ~}+_^[ËE m{-SuE +u M+ȋ_^[ÃC;ssCW3uA ljE){;C +E{}+CM;~ SM+ xE_^[USVW]E {u SLC u(C% tfKH@ _^[CD t]E?fE<@ǀ4@;sF@ t VH ;rEE;E} E<@uCC tC +CPsCPT CC{| _^[Ã{tfK fKC% tfcC_^[fNRÐUu}PÉUSVWEEȋ=r@UEEȋ=r@}} EQE=r@_bE=r@=r@_bƹ<5_bp=r@_b FWfl=r@ ul=r@  ul=r@  tnm+Fƍl=r@ ul=r@  ul=r@  tnm;UkF }bFl=r@ uFl=r@  uFl=r@  tnm |5_b߉=_bl=r@ ul=r@  ul=r@  tnmnu q@+ q@+F;q@}q@C_b5_b_b_b_^[ÉUSVW5_b=_b=_buE|_b_bE+^bEEPB _bѹ _b=_b)CE t u={W}w`/{Jt{KuC4 r@C<$r@VSWSkC<Ck<E;u|;uu E;_b E;};}u E;x_b E;~ }t}u;}U}u}tI;}u+E;x_b} x_b+r@;E}EPr@EEPC _^[fSV\$t$ =_bua:|\Fl=r@ uFl=r@  uFl=r@  tnm؃=_bu^[Ë+FF+_b=r@+^[ÐUSVW_b50r@CF  uE@@4Jr@_bCF CF CF CEx@4`r@CF CF CF 0S|؃NjdPSf؃NjdPSP؃NjdPS:؋Exd|C2C0E@dPS؍_b_^[ÐL$ A|$ |"A$D$=r@=r@0$A A$D$=r@0$US_bhr@5 ;f:uChSh^bShSءu@_b;tj,ur@C(hr@S{ء^b+r@r@;tCh_bh_bS hx_bh_bS [r@_b+_b_b x_b_b[Ð VWT$D$-D$ tB+0|9k B ЋktEà ~<0|9~,-t$:t+t,t GF E 4u@5؃}9E u@CÃ}CM u@ |E u@@_^[ÉUDSVW} ]E_bhr@hr@EP uEP"ff ftfutSECÍuCFƊ t,t/uEP/+E؉}w_bl_bh|_bYE@E@ u8E_bEP!EЋ@ECÍuCFƊ t.t/u u_^[EP.EEE;EEq@}}EЋ@l=r@ uEЋ@l=r@  uEЋ@l=r@  tnmnuEq@E@=r@UEq@E=r@UEE;E8?~CÍuCFƊ t.t/u u_^[EP-ECÍuCFƊ t.t/t,uEP^-E̋E;E} E+EE+E̹+EEċE;E}!Eč AE̋M;q@|_^[ u_^[,uC_^[CfftfuCÍuCFƊ t,uuEP,uCË_^[ÉUEPuU SVW]]+EFƋE8t E=u=@FfVS7 u.E=u+@=t@M EE_^[Ãǃ?u+_^[ÐVT$t$ fF :uB=u^ uF=u^+^ÉSVW|$\$t$;u+_^[f |F :uC u+_^[ }+_^[ +_^[fU$SVEEE܉EfEuEPVu  ؋E^[ÐUSVWEDž Džw@؋w@EƅEu _^[Í@;@u?8%u@%t8tr%u@%tSu+, @D,b + ,b u_^[Ë%unf,b u,b@ t@A t̋$u#u uO"u _^[fE8"EE%@;@uE8t^E%tSE}tHE8t@E%t5}u+&E @D,b +,bEE벋E+u=E@x}uP!8EkE@% t;EM+QM1H/ M+ uE+PhO-E@ t _^[Í@;@uE+ERE+u+D u+3 @D,b @I;,b;E++E+; u+P u+9 @D,b @I;,b } _^[ËE+;aEEE8EDž EE,b u,b@ t@A t̋$u$u& @E+EEEȉẺEЉEԉEfEff=B|ft0futFEEFC E}~ u卝P8u@ܝ4tj0 } ؉ t?fH =4u@0H učC;HsHH0H08u@ܝ4 t+-HH=,bǃ u,b@ t@A  tEeH}" P+ȉH"ȋE+E }}E uE E H4H8 4H8,P0P}<}E<P84؃,t,E;0|8u@ܝ4uw@L&}tw@L}t w@LP,b u3,b@ t@A tC tFP 0 Dž$fF ~  u $ t0$$C }u}~7@;@uF.!h!#PV">tF}<}E< E+ E܃ |[F00~  u $ t0$$C땍P}s+ËM++M܉M_}} E }uE uE E H4H8 4H8,P0P}}EP84,b u,b@ t@A B8u@ܝ4u Dž0E쉅$}uJS ;$} $$|$0u $ۃ0| 0;E~$E$+0ELjPqEă}tg uE E @ PPe2 } _^[ÍP؋  uE E @ `b`b% u%`b=`b`b% u%`b=`b`b% u%`b=`b`b%S`b%R`b%Q`b%P PP u+@P u+1P @D,b @I;,b } _^[Ãu DžP؋}t+EȿsEă} uE E @ }}E쉅}}.@@$ȉ E쉅8~~u,b t@;@ t,bP5,bPP~/$)E$)s} )E}} #e}uR#E;E f8,b t@;@ t,bP5,bPPg. } _^[ÍP u+@P u+1P @D,b @I;,b)E}A+0 uE E X  }}E쉅}}VtE8;u+D u+3 @D,b @I;,bEu+, @D,b + ,b A}}S} u+8 u+- @D,b @I;,b)E}>t7 u+# @D,b +,b yEO>tIE}|? u+# @D,b +,b u _^[Ã}}E}}E}ts t+=0u@+É E E܉L u+L@ uȍE+Hȉ$}fEE;$E@x}u `bP!E `btR`b u+@`b u+1`b @D,b @I;,b } _^[EFL E@x}%uLL`bPV  ELL`btR`b u+@`b u+1`b @D,b @I;,b } _^[E4E}E@x}u0`bPE0`btR`b u+@`b u+1`b @D,b @I;,b } _^[EK }(sP 80Sr( } _^[à u+8 u+- @D,b @I;,bu4E@x}uPD)EE@% E u+8 u+- @D,b @I;,bPSE08 u+8 u+- @D,b @I;,bȋRu u+8 u+- @D,b @I;,bPhSE@ t _^[Í@;@uH u+8 u+- @D,b @I;,bE u+8 u+- @D,b @I;,b u+8 u+- @D,b @I;,b;5 u+8 u+- @D,b @I;,b+ u+H u+5 @D,b @I;,b } _^[Ë u+8 u+- @D,b @I;,b;6EE u.E@x}uPdETE@% t-E SM1  u hSE@ t _^[Í@;@u E u+8 u+- @D,b @I;,b;  +;  u+H u+5 @D,b @I;,b } _^[Ë; pEEE}E@x}u0`bPE0`btR`b u+@`b u+1`b @D,b @I;,b } _^[EKfH E@x}%uHH`bP EHH`btR`b u+@`b u+1`b @D,b @I;,b } _^[E4EE;$}E@x}u `bPBE `btR`b u+@`b u+1`b @D,b @I;,b } _^[EFE_^[ÉU(SVW]+uEE=w@w@w@Pq`b5w@^ `b=`bt = `b uw@+_^[ËEE;w@}E `bEE܋E;w@|;2%t8 u+# @D,b +,b u+_^[EC+k MЍ<CE裼,b u,b@ t@A  uC;}~}E;w@w@w@P5`b`b5w@5 `b `b=`bt = `b uw@+_^[ËEE;w@}E `bEE܋E;w@|fft ftfuC,b u,b@ t@A tC* CÉ]f,b u,b@ t@A tC$uE;E~EEE;w@w@w@P5`b`b5w@5 `b `b=`bt = `b uw@+_^[ËEE;w@}E `bEE܋E;w@|E `bdFC.DC,b u,b@ t@A u׉]* CÉ]C,b u,b@ t@A u$u;E;E~EEE;w@w@w@P5`bX`b5w@5 `b? `b=`bt = `b uw@+_^[ËEE;w@}E `bEE܋E;w@|E `bdFCEfftftftfuECECÉ}Cff=%|7f=C|!ff f=5$v@ff E `bE؃}tldM؈FNE `bnF:E `bfF&EE `bE؃}twdM؈FEE `bE؃}tWsM؈FEE;EE `bff=W|3f=d|!ff f=$\v@ftvfE܋ `bE U E܋ `bE U E܋ `bE U RgE܋ `bE U OE܋ `bE U R7E܋ `bE U RE܋ `bE U +_^[E܋E;E`b_^[ÃSVW\$ +D$ fftftft futGCCf0|79/k C Ћ;D$ }H@"+_^[Ét$ t _^[Ë_^[ÐUhuuuu u$ÉUhuuuu uÉUE}fEfEf fEm]m̋EĉE0Em |x@];rF5|0`b;u`b1}tG09`b_^[É(SVWD$8D$D$;F à t^[Vu ^[^[Fu:F]hEPFP u^[fN ^[Fu~ u);Fu~ t FD   t V<+ t ^[FD VCF~}VP F t ^[^[fUSVW]{+ljE;CD t+C +CCC +E{}+CM;~,]Ëˋ@ + } EȋI E;p}EpE}~DfuEPCP E~E)EEE}fK _^[+_^[USVW]Ct/C% uH@ _^[CfC{u S];CuLCD uAC +CCC +E{}+CM;~G + }G ;w}w+_^[USV]sC t hCfKCC ]}<@CC DhC tfKCC hCfKCC CVQ tC ufK@^[ÉD$L$@ + }D$L$I ËD$;P}D$PÉUSH@EPhTu } H@+[ø[USVW=bbuxUbbh؍GO#+‹ }bb tWlu+_^[+Ebb;EveFơbb;Ew5bbbb;ErE+bbE5bbE;Es fe}u+_^[FƋE;Ertbb uV.tbb u+_^[ËtbbƈCC_^[USVWEȸ ~V;5bb}=bbǙE=bbEWQ؃tEtbbE}~ _^[f|$uËD$tAЋtbb tbbUSVWE}uu _^[ËEu EG.hW }5p|@W }Fȸ;bbs bb؃}tF t%Fȸ;5bb} bb;] r ;u sE_^[uu EE u+_^[ËE;Et;] vE Puu4 E_^[ÐW+Ƀ}-+tbb;T$u_GNj t;|$ uA|Ӹ_USVWu~}FF t F؋HF% t'+F t.~t(F u+FH@ _^[+ ~(hhFP u _^[Ëǃ thhFPO hhFP4 |_^[ÉUVWu} Mq;w$g;r-NOIft3ft,ftftIt(ftft rft_^]Ð>ÐL$ D@Dbr[L$r D@ D@ãH@ËL$Dbr&r D@ãH@H@ÐVÐBø*ÐÐ6ÐH@ÐVWT$t$ t u+_^á@x f;w;w vG tLG t*G%BO_^ËG%_^Ë+GD$G t###||AAAc||++cY++--|-+aA++--|-+*dDEEEiIII++##|I#OBOOoOmIIUUUyY?'-?_???%,o".132##????????????????????????????????.??HDCS@@OO????*><^!??#-^v>/+<>???????????????????????????????????><+#v^|?<>?%'?u??+Lx"=yelhi((%&kwnorgq))~xcuz||0123456789|?YPL?b?~?????X?DU~~04567890P~||++++||---++++++##abG?SstFQOd8fEn=????=o?-n?-?uvo)@(#)putpwent.c 1.8.1.1 AIX%s:%s,%s:%u:%u:%s/%u:%s:%s @(#) getnetgr.c @(#)getnetgr.c 1.10 1.10 LCCgetnetgrent: getdomainname system call missing Cycle detected in /etc/netgroup: %s. lib.cat # syntax error in /etc/netgroup --- %s netgroup@(#) innetgr.c @(#)innetgr.c 1.8 1.8 LCCinnetgr: getdomainname system call missing lib.catnetgroup.byusernetgroup.byhostinnetgr: recursive overflow lib.catnetgroupinnetgr: netgroup %s called recursively lib.catinnetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup # *@(#)sfnum.c 1.8 AIX@(#)sfent.c 1.15 AIX\@`@f@l@r@x@/etc/site/etc/sitevaxi370xa370x286i386romp@(#)NLstrncpy.c 1.9 AIX@(#)cuexit.c 1.8 AIX@(#)rew.c 1.7 AIX@(#)fputs.c 1.10 AIX@(#) yp_enum.c 1.2 LCCYP_@(#)bcmp.c 1.1 AIX@(#) yp_match.c 1.2 LCC@(#)yp_bind.c 1.5 AIXload_dom_binding: malloc failure. system.cat@(#)sleep.c 1.19 AIX@(#)sigdelset.c 1.3 AIX@(#)sigfillset.c 1.3 AIX@(#)sigmptyset.c 1.1 AIX@(#)sigismemb.c 1.3 AIXټҼǼ˼@(#) ypprot_err.c 1.2 LCCܽ0h@(#) ypv1_xdr.c 1.2 LCC @(#) ypxdr.c 1.2 LCC@(#)printf.c 1.8 AIX@(#) stat.c 1.2 LCC@(#)mbtowc.c 1.4 AIX@(#)wcsncpy.c 1.1 AIX@(#)wcindx.c 1.6 AIX@(#)mbsadvance.c 1.1 AIX@(#)mblen.c 1.3 AIX@(#)catgets.c 1.1 AIX@(#)'src.com/lib/libc/Lposix/setlocale.c, bos, 130, 0012' 1.3 AIX%m/%d/%y%h %d %Y%a %h %d %H:%M:%S %Z %YCSunday:Monday:Tuesday:Wednesday:Thursday:Friday:SaturdaySun:Mon:Tue:Wed:Thu:Fri:SatJanuary:February:March:April:May:June:July:August:September:October:November:DecemberJan:Feb:Mar:Apr:May:Jun:Jul:Aug:Sep:Oct:Nov:Dec%H:%M:%SAMPM-.:,at:each:every:on:through:am:pm:zulu.:,:3:$:$:.:,:3:+:-:2:2:1:0:1:0::1:1now:yesterday:tomorrow:noon:midnight:next:weekdays:weekend:todayno:n:Nyes:y:YCCCC.eb.cctC.eb.cctsetlocale: Unable to open %s file "%s" U@U@U@U@U@V@ V@V@ V@ (V@ 0V@ 8V@ BV@JV@RV@\V@fV@nV@xV@V@V@V@V@V@V@V@V@V@V@V@V@ V@ @ @ @ 8@ <@x@@@@(@,@0@4@8@\@@@@@@@@ @ @ @ @ 8@ <@x@@@@(@,@0@4@8@\@@@@@@@@ @     P"@"@"@"@"@"@#@C C C C C CXXCCCCCCC%s %s %s %s %s %sCCCC.en.enrconfigurationsetlocaleLANGCLANGCOut of memory Out of memory Ccollationsetlocaleread errorsetlocale: bad magic number for ctab file "%s" lseekmallocread errorread errorread errorsetlocale read errorsetlocale lseekmallocsetlocale lseeksetlocale read errorCcollationsetlocaleread error:setlocale: bad magic number for ctab file "%s" mallocread errorC.cct.cctconversionsetlocaleMBCS_CFG_DIR/usr/lib/mbcs//  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~LANGLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGELOCFILEMBDATEMBLANGMBLDATEMBLDATIMMBLDAYMBSDAYMBLMONTHMBSMONTHMBTIMEMBAM_STRMBPM_STRLANGMBCURSYMMBNUMSEPMBTMISCMBMONEYMBTSTRSMBNOSTRMBYESSTRMBCOLTABMBCTYPEMBCONVTMBNLINMBNLOUT@(#)memcmp.c 1.7 AIX@(#)perror.c 1.15 AIXError %d occurred.: dd@Y@Y@[@\@]@^@_@a@4b@c@Y@Z@0[@D[@X[@d[@|[@[@[@[@[@[@[@\@(\@<\@`\@p\@\@\@\@\@\@\@\@]@,]@@]@\]@x]@]@]@]@]@ ^@^@@^@T^@l^@^@^@^@^@_@$_@<_@X_@x_@_@_@_@`@ `@8`@T`@x`@`@`@`@`@a@0a@Ta@xa@a@a@a@a@b@ b@Hb@Xb@lb@xb@b@b@b@b@b@b@c@4c@\c@c@c@c@c@d@$d@E*LJ*L*L*L*L*L*L*L*L*L*L*L2N*L*L*L*LB*L*L*L*L*L*L*L*L*L*L:LB>E7HJ*LB*L*L*L*LBBB*L*LLN*LB*L*LB?@@?@@@@@@@?@?@@@deheeeeeedeeeeeePeeee edbdcbdcbdbdbdbdbdbdbdbdbdbdbd4dbdbdbdbdcbdbdbdbdbdbdbdbdbdbd dccccbdcbdbdbdbdccbdbdbd7dbdcbdbdc@(#)doprnt.c 1.33 AIX-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ @(#)atoi.c 1.9 AIX@(#)ecvt.c 1.10.1.3 AIXnF nF 7yACחA@Y@$@QNaNSNaNINF?$@@CfTg gTgTgTg!gTgTgTgTgTgTgTggTgTgTg5gTgTgTg,g@(#)strlen.c 1.7 AIX@(#)fwrite.c 1.9 AIX@(#)memchr.c 1.7 AIX@(#)nl_langinfo.c 1.3 AIXnnnnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooGmhmmmmmmmmmmm n n n n n n n,n,n,n,n,n,n,n,n,n,n,n,nLnLnLnLnLnLnLnLnLnLnLnLnononnnndd@(#)mktime.c 1.2.1.3 AIXM:/;Zx0N@(#)wcslen.c 1.1 AIX@(#)flsbuf.c 1.12.1.4 AIX@(#)isatty.c 1.7 AIX@(#)malloc.c 1.20 AIX@(#)ftell.c 1.9 AIXcbcb cb|@sbcbDb@(#)wctomb.c 1.1 AIX O@Q@M@M@O@tM@M@?MB1C@@@(#)cleanup.c 1.1 AIX@(#)_cleanup.c 1.3 AIXctim kꜯ/m1;+P+㯄-'./usr/bin/fuseruP+  IWP @.text I .data @ @WI@.bssa@a@ÐUSVWh @[ V @;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tPh @h t:+'4 @fV*tƃ>uCÃ< @u_^[ÐUSV]s 3ssH t4s {t%{tC0s'PVsp +^[ø^[ÉUSuD u%hu6؃u+[Suuu S[ÐUS+; @fa@@MEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u a@[C; @'+[É= @1uË @ @L$ a@+fUS+; @}4a@C; @| @[ÐUSVW+; @}phV=t } |BVa@@@PQ9t%a@@@PM>a@@fpC; @|_^[U= @u8Tb@ @Tb@Ð SVWt$ \$D$ i u+< u+1 `@D `@I; `@D|$ D$$;D$ |ǃ t CF D$ ;D$$}>u_^[ É7ET @RU RP^]- @ P- @gjUSVW}] h @D$p@h @2$p@h @ $p@Ãlj -@cu4Ã8uà @p@p@뫋@nu#Ã8uÃp@}@Du` @Ã]}h, @5p@7=q@u%5p@h" @h[@ hef5p@5p@5 @) u 5p @h[@kh&f= @uht#u heh5q@hn@N- 5q@$+q@5q@+q@5q@*q@5q@*q@\o@+q@=$ @p@5q@h5p@*+ p@ho@5q@E;}Df-=( @t + @\ @( @EeEfftfu/t%= @th4 @h[@ ,\ @$ @EP5 @h[@ EE u( @3hJ @h[@ P3L=` @t hP @h[@l5p@DžF Fhq@h\b@V% =` @thd@hf @h[@ p%`h3~$E }3hx @h[@ E3hhPhu Xb@u8hqPZDžvph @h[@(  th @h[@  th @h[@~"h @h[@h[@.= @t F\P=\ @th vp%bơp@ip@;h @ہE;}h @轁ha_^[UxS] hxEPuŁ uu聨[fEfCxECECE+[USu3 uuh @h[@ [3h @h[@~ [Uhuu ( +ÉUh @h[@JhafUhuEPQ( }tu uøÐUSVW}+ xq@;4e@wR(n@ Hq@;4e@v2P54e@0 uG;uG;u=8e@uG;o@u G;o@t\q@;8e@wR(n@ Hq@;8e@v2P58e@ uG;uG;u+ہ@@k+^}@f ~ƙ=| @ u hf@qkhh@]kFƁ^|Ëƙ=| @ ~ hl@8khn@+k+}? ~ƙ=| @ u h~@k h@jFƁ|Ëƙ=| @ ~-h@j_^[hu h@_^[SV\$ s@ |0Ù= @05|s@ù u }ҍ5|s@^[US]à |Ã~~h[@=[@}h[@h\k[@[@\ff |$f= $ @0KtGnCr?b;?7[@=[@}h[@h [@[@ [@=[@}h[@P[@[@Ã[@=[@}h[@h [Ë[@[@ [USVW+fFƋE <uFPX +;}9ljEE _u E @ E EȋًMC;|ȋǍ @WuL+;}fE DϋIC;|Wd_^[U$SVW} 5@MEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tƃ~9F | $@h@}tuh*@IgG=@+Ù=@ uN t7[@=[@}h[@h T[@[@ EPh@@fhEPEP] u~uD@N@PfǍ;Z}tuhV@rfG=@+Ù=@ uN t7[@=[@}h[@h |[@[@ EPhl@fhEPEP EP~ up@x@PeǍE;X}tuh~@e+;fÙ=@ uN t7[@=[@}h[@h [@[@ EPh@0ehEPEP ~uEPE%Ph@dC;WL+;BhEPEPX [@=[@}h[@EP[@[@MC;|}tuh@bdǍPEǍPuu +;Ù=@ uW t7[@=[@}h[@h L[@[@ ÍEPh@c h@cE4h@cC;qu[@=[@}h[@h _^[Ë[@[@ _^[fUuh@h[@ÐUuh@h[@ hFCUSV=@uFh9P]=v@P*@v5@uE5@MAQ5@SXuSd^[fUh@KPh@u"Uh@+Ph@uUS]E 8tSh@h[@r [ u]E EhSMu(h@ЈSh@h[@% [Ít@%@+[ÐUSVWu=@uh@h[@_^[ËE t _^[Ã}| | E~2h&@h[@VuhB@h[@x_^[ËE  EE%hW5@n uhZ@ȇ_^[ËEE }EE Pu5@5@y@E;Et/}u hd@Zhn@h[@_^[ËE+ljEE+E;~SE@PuN  ]+]E N+_^[fUSVWuu=@uh@h[@1_^[Ã} | }2h@h[@ Vu h@h[@_^[ËE %hW5@ uh@S_^[ËEE }Eu5@5@  E;Et/}u h@h@h[@H_^[ËE +ljEE+E;~SE@Pu ]+] E ZE_^[ÉUh@ÐUh@ÐUE8uh@h[@ËE0uh @(ËE+ÐU@SVu Pu u+^[ûh PV }t huE u+^[0/t 0 uFxtFxt+^[ø^[USVWu@@EFu+_^[ËF  t=@t+_^[ tQ+@M薇hhEP E PWu+_^[C;^+O%Ehu E P uvpuh\@h[@+_^[C;_^[USVW]} Ĕ@Ȕ@@ t& u}th@h[@_^[ tJSu,5@^@<PSh@h[@L_^[@@ tDhWȔ@u,5@^@PWh@h[@_^[Ã}tHhuxĔ@u.5@^@Puh@h[@_^[_^[ÐU=@t5Ȕ@5Ĕ@Ĕ@Ȕ@̔@@fUEhuEPN EÉUEhuEP& EÉUEhuEP EÉUfEhuEP EÉUEhuEP EUSE mPT  u!E mPh@Yh :E mPuS^ [ÉUS] u 8@[;8@} 6@[ShB@ht@ t@[ÉU} t,uu 5@^@PuhR@h[@u5@^@yPuhx@h[@ÐUuu5@^@LPuh@h[@Z} tuu uh@h[@9uuh@h[@ÐUShu 5Ȕ@1 u+[uu5Ȕ@ ;Et+[ø[USVWu=@uVu u _^[Ë}ދE %+;sE %+ˋ v6Vu PW- +u vË w̸_^[ÉUSVW] }=@tXSEu _^[Wuu ;VWSPSh@M_^[hS5Ĕ@  uSSh@ _^[Wu5Ĕ@ ;tVWSSh(@_^[+_^[U SVW=@uE_^[ËE4Д@%M  <hWEP E%M_^[fUSV=@u+^[hhhԤ@d u&Vhhhh<@^[Á=Ԥ@ t!5@h\@h[@m ^[ؤ@t;h@h[@Fhؤ@P5@h@&^[Z@SФ@=Ф@uSh@h[@ ^[Sh5Ф@n u*5p@{Phh@ ^[h5p@LPhД@ u0Vh5p@%Phh@^[+^[USVW}++BФ@;<|)Ф@ Ф@L ;}Ф@+ ΋_^[áФ@DCZ@;Wh0@h[@ _^[fUH SVWEE] @˖3Ë3 t uڋ+E =\@EhuE } _^[hEPug Eut!ELtuL _^[huu  EẺE}}EEkPPu E)E䍽<f}t E'Ǎ t@@E=t@x@;E|x@;E=x@hhuP hkEEx@Pu, hPu! u_^[hu  tۍx@E؋E؉Eԍ x@+ME] EN:HE:F FMVЋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ Ë3 ] fF:u@:t@F F:v@uoF txF:w@u\F teF:x@uIF tRF:y@u6F t?F:z@u#F t,F:{@uF tF tË3 N.|@Cf@fC @C f@fCE}tE}}ou{+_^[ÐÐÐÐÐ$nÐUSVWu} hVU |;u_^[WWhV. }=@^@u @^@ _^[fU5@US]hh@J }7h@hhh@覢Ph[@ h.=@uh@S@5@.=@t5@X@Z[fU5@uÐU0SV] S/=@u+^[u@PEPu 5@hh@v tuh@Ph@ E t‹E0@PEPE0- E0MEPEP E0E^[+^[US]5@S [fUSVu ]V1=@u+^[f5@hPu tJPPP E tSEPPO tE^[+^[ÐU=@t5@@=@t5@\@^fUuhPt u+ÍPPP ÉT$:t:t  tB u  tBÐT$:t;t :tB:t :tBfT$:t;t /tBfU5@USV]@ u5hh@F }h @h[@获hI+=@uhN@S@ u+^[Ã=@tL5ܸ@5@5@T 5@ u+^[V u^[ÍPPP= tB}5ܸ@H _V% N^[5@hPr u+^[ÍPPP  u+^[fftfeVP@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uV ܸ@ @uLVp ܸ@h@hR@hP t >P V$ ܸ@5ܸ@@Pq VN  w^[@uyh@hT@hP t+^[ËPPPP tt' 5@P V  ^[USVW} EfftfEVV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u1SX VW tE_^[+_^[Ë@@uNh@WhPX t*SVWW tE_^[+_^[hW@PI SV@P  tE_^[+_^[Ë@@u0h@WhP tZE_^[hW@P u1E_^[hW3虱 u _^[+_^[ÐU SVW} EfftfVX@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u0SVu* t _^[+_^[ËE@@udPPSVu t+h@3hP t _^[+_^[StV@P tC;Eu _^[+_^[ËE@@uZPPoh@u7 tbh@3hP> tC_^[Ë@P2;Eu"_^[ËC;Eu _^[+_^[ÐUSh@u tC[ø[U Sh@h@EPEP5@5@hZ@h@@' t @=@t5@E@E@[fU Sh@h@EPEPhh@h@" t @=@t5@E@E@[fUSVW] EPEPuPuhv@h@.+ t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[ÐU$SVW] uh@EPi EPEPEP PEPh@h@X* t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[fUSV]u ue u+^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$^[USVWu uh@G @E @ E @@+@S؉@S:u u+_^[h EPS; ]C:t u+_^[ |  tǣ@:u u+_^[h EPS ]C:t u+_^[ |  tǣ@@S؉@S؉@S@;t ,tC;tC@@@@@S/u*ChEPS ;]u]=@S;u C@@_^[ÉUSظ@ t3S[ uظ@[ÐUSVh u@PuSdظ@F5ظ@^[ÐUS]= @tN @pH @p8 @p ( @p$5 @ h(a @ @Es@P?MAs @p @Es@P MAs @pp @Es q@PMA s @p : @Es$;@PMA$s$ @p$ @[ÐUSVE5ظ@ EVӋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u ^[Ëv ?+^[ÐUSVWu]E} tE  |$~+_^[E@ u@@ l^@A  uLE@ u"@@ l^@A t CEϋEtu ECE u+}0t Cxt CXuE@ u@@ l^@A  E@ u@@ l^@A  tEBE@ u@@ l^@A  t E E E;|+_^[ÃuJ}0uDC@ u4@@ l^@A% tCxt CXu EE@ u@@ l^@A  tEBE@ u@@ l^@A  t E E ؋ +ECE@ @@ l^@A E@ u@@ l^@A  tEBE@ u@@ l^@A  t E E E;?} tE }t_^[Ë_^[ÉU$Su u[EE E܉EfEEPSpEuu x+[USVWEh@h@ u _^[É}Whh@` @5@f:t t;tFC܋EEVЍ5@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ EWx}u _^[Í@EuEu u +_^[ÐUSVW]+S u++ E ψ 0Fƃ ~S u+_^[À;t,f uCSeE S+_^[ËD$@ÉU SVWu }]u u+S u+8 u+- `@D@ `@I;@@|@+E lFE^@;`@t   t@`@@PSh@5 ~@+s\^@;`@t   t@`@@PSh@J5 ~ @+^@;`@t   t@`@@PSh@4 ~@+Ph@u@;@  t@@?ME FC  t ; ;uv u+E_^[ÐUSVu ]s3h@V蕟C tsh@Vz ss sh"@Vc{tsh,@VL {tC tsh0@V+ s$s h4@VF ^[ÐUS]VӍ5 @;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u @@[Ã=@t&S@@Sh @[ÉUS@ tC{t s~{t sm;t 3^SU[ u@@[Ã=@t<@L$@L$@@L$ @@@ @+Uhh @, }hj@h[@<hhuÐUSVWuE I} MEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u2uh@h8hh@蔃Ph[@ _^[Ë  hEE G} ] f t uC #(uvh~ECh,PS h,EPS t|h)EPS taE @H E@.h@SW t#tVu S h@S) _^[h@h[@̚uh@h[@跚 _^[fUSVW]C t tEPS u+_^[;u E OG t t+@E@P M uSE 0t EM G_^[USEPEPuqPuh@h @ t+[ËE[fWL$f t|$ :u_Gǀ?uA+_fUhh0@( }7h.@hRhh\@׀Ph[@Qh 0@P@E (@E$@E,@=,@tv=$@t2=(@u)EP5,@5$@uhd@ t@EÃ=(@t2=$@u)EP5,@5(@uht@[ tEuÐU0SVWP@P@M0@ ;P@s8h@hThh@Ph[@?P@+_^[ËEEuEEPEPuuh@h0@E؃tP@+_^[Í=0@P@; MEԉMVЋEԋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u;uh@hShh@p~Ph[@ P@+_^[ÃǡP@;]E E t uC }#q(CÐ t uCh,SГE u h@h[@1P@+_^[;t =(@uE:F t F u+PS5(@肕 uE]C t uCh,S4E u h @h[@蕕P@+_^[;t =$@uE:F t F u+PS5$@ uE]C t uCh)S蘒E u h: @h[@P@+_^[;t =,@uE:F t F u+PS5,@J uE]C}uouP@_^[hd @S{ t#tO tS tuP@_^[ t hj @S( [uP@+_^[ÉWL$f t|$ :u_Gǀ?uA+_fUSVu3] fVSuB u3,t 3 u ^[,t   uCCÀ;u+^[ÐU SVW5n @+ۃf tt#t3uTtAuuP ;uVP &VuP VVP EPEPP3PPuh0@ u0uu MuE8t_^[Ãt+_^[CÃE_^[fVW|$T$ t$BF  tB.BG  t_^ÐUSVWf]+ u+ tf;u t[_^[ tK+_^[U= @}3hh @1 @ }+t@x@$ u+ht@hT@!T@ÉUS=t@uGhht@5 @V @=@t x@t@|@t@t@ CÃ=x@t|@@;+[Ë+t@~+[Á|+t@|@5|@t@t@Pht@( +|@P|@t@P5 @} @+|@;@t x@t@%+t@@Pt@t@Pht@ t@t@=t@| t@[fU= @|A5 @hh @; @ }+t@x@ @fU= @|5 @ @ @á @ÉUSVu ]+CC+CCC ffCfCf VQfVuCVgCVYC tGVGCV9CV+ tVfCs MfC^[ÉT$ u+Ð:t t  tB:u B+ÐUSVW]= @5 @;EVЋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u F_^[Ã;=+_^[ÉSVW|$(\$ t$$\$ t u +_^[D$$f|$ ~lD$ D$ ~ CF  u+8 u+- `@D@ `@I;@D$ D$ D$;|$}+D$;}D$_^[ÐUSVW}]u WVSE" _^[ÐkÐ%UuTÉUS]SshhCP, CCfcC% tfc[fVÐUSVW} t}u _^[uu  t@ t@~ _^[fEPu  t_^[ËExhunoEuuuu5 "@5"@uu uU$؃uuz 5"@$_^[ÐU SVWu}+ۋEEE E+EE+EEuuEPċPEPTPhw`G`@ t _^[Ã}t u uIEPA t/E$EMQ&M u6 u[E Mu6u E E@E(MuE$0u EM$ E@M$EPċPw`G`@P _^[ÐUSu(u$u uuuuu u4$ t[u(u$u uuuuu uj$[U0SVWu}+EEEE EEEEEuuEPLPEP(Phw`G`@ t _^[Ã}t u uIEP t/E$EЋMQsMЉ u6 u[E Mu6uX E E@E(MuE$0u, EM$ E@M$EPLPw`G`@P _^[ÉUSVW} t }t}u _^[u7u * t@ t@~ _^[ÐEPu4 t_^[ËExhursEu$u uu5 "@5"@uuuu uU,؃uu5"@>z_^[fU(SVWu$}+ۋEEE EEEEE+EE+EEu uEPċPEPPhw`G`@ t _^[Ã}t u uIEPM t/E,E؋MQ2M؉ u6 u[E(Mu6u E E@E0MuE,0u EM, E@M,EPċPw`G`@P _^[ÐUSu0u,u(u$u uuuuu u6, t[u0u,u(u$u uuu up$[ÉU0SVWu$}+EEEE EEEEEEEEEu uEPLPEP(Phw`G`@ t _^[Ã}t u uIEP t/E,EЋMQkMЉ u6 u[E(Mu6uP E E@E0MuE,0u$ EM, E@M,EPLPw`G`@P _^[ÉUSVW+++ 5l!@hh!@E0 urEE 0EE E$0E$E(u(u$u uuuuVSu u ,S+j_^[fUuuu k=ÐUSVW} t}u _^[uuu h t@ t@ }t}u _^[fEPud t_^[ËExhuLwUSV}u @ EEVS;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ucEPEPs\ uEtfCdf;Et  tC\u'+E ^[Ë +^[ÉUSVWu@Nfho\bfFhFPVhhhU ؃uE +_^[hVS }S;E +_^[S"_^[ÐUSVW}=@u+_^[Í@Of5@afGhGPFUhhhT ؃u@E +_^[@^@hWS Sj tu#=@^@Ct@E +_^[ø_^[ÐUSV@E视E EEEEhhEP5!@5!@hhu(@ uE+^[5!@5!@h@`PEP(PhSC SCPuu u!=@t ^[ËE +^[5"@6E^[ÐUSVWu E>u }~hhEP5!@5!@6hu7? uE+_^[5!@5!@ulPuЊPhSC SCPu uCE8u _^[Ã>u}|>u5"@FE_^[à u>uE +_^[5"@@E_^[fU=@tu EP u+u uEPÉU(SVWuE+hl9 u7h!@h-hh!@^Ph[@w+_^[ËE{LfCHEf@fCJhCPPQEf@fCXC\} uChh@hC\P5!@5!@} uPhCHP= C` uS+_^[hhs\߾ fEEfEhEPPhEPs\ tS莻+_^[ÍEPEPs\ u fEfCdSW+_^[uCP@@_^[USVWuEh@hEP5!@5!@hhFHP; tz5 "@5"@hPhPhSC u/v`F`@Pv\F^`EF\Fh_^[SCPu_^[f@U|SVW] u+_^[ÍEPdEMEP EPEPh$ u+_^[Í("@MEEEPEPh| }uEPhEP t uEPEMEEEPEPh1 uhEPhR +_^[f@ t;vE؍E̍M+EMؖhEPh u3hEPh hEPh +_^[ÍEMhEPh ]hEPh uhEPh[ +_^[ÍEP`EEPEPh hE}u}t;}| +E E+Nj t&;}+uhEPhe hEPh{ hEPh ;}} E+_^[+_^[VWT$ t$ t |?~@^@_^ÃƍB <θ!+_^ÉWT$ u@^@_Jy;s;r+_ÐWT$ u@^@_Jy;s;r+_ÐVWT$ t$ t |?~@^@_^ÃƍB <θ# _^É.úÃÐøڹø¹øøøzø b|$tT$øBËD$ |A <$"@+6/(! Uhh"@E PE Pu(SÉUhh#@E PE PuSÉUE EEPuH tE DPu ÉUhE PE PuQfUh@u uRfUh@u uRfUE Pu tE Pu  tE Puj ÐUE Pum tE Pul fUE PuM tE Pu fUE PuM tE Pu  tE Pu ÐUhE PuOÉUE Pu thE Pu[O ÉUhh<#@E PE PuPÉUhu u=QfUSV] uSV tCPV  tCPVyL  tC PV ^[ÐUSVu h[@Vul [@ t ^[Ë^[Uhhdu uÉUhhdu ulÉUhhdu uhÉUhhdu u4ÉUu hxuu2Uu hxuuøøUSVW} t E  u+_^[ËE `@0f:^:^F t]ǃu:E x:~:~ }F M}F M|ǃuBE x:~rQ:~ wL}tZN+NV+AN+MD.}t(N+MD6 _^[;}~ _^[Ë_^[ÉVW|$T$t$T$ t u_^f |)ƒ΃  u吃 |ۋƒD$_^USVW]5@^@t{u5@^@E_^[Ã{u SlT؃u5@^@E_^[Ã;teC @;E rHE k C@;Ev6EM k KI|t 5@^@EM k KID_^[É5@^@#@_^[uu S肢 t?t 5@^@_^[É5@^@E_^[ÐUSVW]u |~+_^[ uS?_^[ uS _^[V@+@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uSSi_^[CuRF@uGSSFPh thS S_^[DžfGF  t"G@uGSVh9 PS% t+_^[S_^[ÐUHSVW] hͪu _^[ËE tD}tExuE@E}u担MH EHE$ȉH @@EЍEԉEE+ɈEǃt t4EEC  E@=uߋE@ u+8 u+- `@D@ `@I;@;EMQ!Q AhAxu _^[Ë@H @EЍEԉEE+ɈECh u+8 u+- `@D@ `@I;@ +_^[fƃ ~EEЋC  uYEMQQA@D;uE$+_^[@t _^[Ë_^[US] t+{t[;[ t[ s踨S譨[fT$ t;D$uD$ Bà ƒ8u+fUS|&@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[à Ã84+[fT$+ t;D$uËA ƒ8uÉT$ t;D$uBà ƒ8u+fUSVW+ۋCM +@4 Vh()@ |k f<0)@tk 4,)@ƃt tu-thB+@ hD+@ hF+@)k f0)@Vh(@2PVh()@ G_^[ÉUSVW]} tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv  ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u6v% u56觢Ek f0)@Ek N ,)@v  t26mvbv uup_^[u[+_^[ÐU SVW} t E  u+_^[hu PPԐPٌPVH+@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ thL+@PhP+@P u5PhR+@h%@h[@;[h`+@_^[+ߐVhPj tQ t#tЍP`ƄEuPS Vt_^[ÉU SVW}Ehj+@BYE tE8u p+@EWPuhf u0WCPh( PhS號+_^[fEk &@E 3uh|&@PXE E8EMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tBuu  u0WCPh Ph<SS+_^[ES;W>_^[Wh|&@E u+_^[uFW t uhr+@,W t uhx+@Wq_^[VWb_^[ÉUSVW]u }| t u+_^[Ã}fE\uFR:uJ u+8 u+- `@D@ `@I;@uF5 u+# `@D@ +@ l u+_^[Ã}SfCF  ts\u CF :uJ u+8 u+- `@D@ `@I;@uC_^[USVuu h()@ u+^[Ã}}SV^[uSVT u+^[Ë^[fU SVW+ۋfE +@< t[Wh|&@\EWh()@KE}t}uFu萆Eu肆MȃF딃Ek  &@EEk $&@ u)S豙E uEhz+@h[@U+_^[SuUE uh+@h[@U+_^[ËEk f$&@Ek M  &@+E@E@E@EE +@< Wh|&@<EWh()@+E}t}uFuuYubEEE=uu4u=EEE;FfEEE_^[Ð=@u =@ u f=@t @ fU$SVWEEV+@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uT-@;t^@tB+_^[hhu PE }?hu Ph+@h%@h[@1Sh+@ _^[hh@u= t"h+@ u(_^[B tOh+@h[@RhuO Ph+@h[@R XuЛ_^[@%u+Ehh@EP tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u8x/@;l^@t#5l^@x/@l^@\^@+_^[hhuP }?huPhv,@h%@h[@Kh,@_^[hh@S th,@\_^[ tMh,@h[@Jhu+Ph,@h[@|J 4S讓_^[@%u+Ehh@EPr t(V5@@V5@@x/@;l^@t5l^@d@EP賍l^@=l^@u5x/@l^@\^@h,@/SΒ_^[á@EEu5l^@S蛇 ;Et h,@S舒_^[á@\^@ t5\^@V5l^@ SR_^[ÉUSVuVtyV,@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u>^@;`@u+^[5`@f^@`@^@`@+^[VPf|3V,@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ th,@PhPP`@ tBh`@Pe^@;`@t5`@ `@`@+^[á`@`@h`@PPh,@h%@h[@Fh,@ ^[ÉUSVWu/t.u_^[h-@D u-@Sh@zh-@h@} t,E  t"u h@fh-@h@TVh@F@_^[ÃVW|$T$t$;t,f | BF +D$ tD$_^+_^fUPSVWhu=@^@|G@^@;8@}:@^@6@^@;`@uw +w ww7~,5@^@h6@V ucu t(Suh8 hh6@h! V,uPVh hh6@h _^[ÉVWT$ t$ u_^ËfB8tBF  t_^fUSVW]sG u+@P tGC  u_^[+_^[U$SVEEE܉EfEuEPVu .D ؋E^[ÐUufU SVWu] EEF% u@^@ +_^[à ~#VuE;Euz+_^[ÃF;^}FWh 6u]E tE+E})~>F +E~}+FM;~ V]}u + jEE_^[VW|$T$ t$D$|$|BF ;u_^+_^ÐÐU$SVW}u@^@+_^[huv }+_^[hEPW\ V L@u;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tW襊@^@+_^[E%u+EuEPfEuEPofEuEP[fEhڄ uW@^@ +_^[CfEfC fCEPC Puh h/uE tE@EPCPe +}3D3FƁ|fEfEf t*uSW }SgW^+_^[fEfEf t*uSW }S/W&+_^[W@^@_^[ÉUSVE tS0 uEp tf6V uu^[ÉU4SVWEhEPu} t@^@_^[uEPfEuuEuuEE u2EM+@EEuEM+@m؉E؋E؃P褂 u@^@ _^[fEfCECECECEC EC EC EE M8GE;}EEEE MЈL8GE;}E E̋E @;E}EE @MfA}hhu Ehuu u؍CPu{ ;EtS0@^@_^[huu譆 Eؙ=L@PuCP E 8uE E 06>u+_^[U,SVW+hEPuX{ t@^@_^[uEPSfEuuEuuEuuEuuEE uE+EGE tGPi u@^@ _^[fEfCECEC EC ~ohhuV Ehuu@ WCPuu+_^[ÃD$ tD$ D$D$ D$D$D$ à VT$t$D$ t&ƒ tFD$D$ƃfL$f^ ÉVWD$ tt4uwtLsD$D$D$D$ D$D$ D$D$ t$|$HfD$fD$fD$fD$ t$|$)D$D$D$D$ D$D$ D$D$ t$|$D$_^fUSV]uE tt-uxtJ^[ËÍ+5L@Pu V ^[Ëà tGfFfEffEƃM܋à t#FEFEFEEƃM^[UW+E+҃}DuBƒ|E |$L@+_Ë3_ÉWT$ L$+:uA8u_ÉUHSVW]h >} uChL@hJhhL@ Ph[@"9@ @^@@E +5XL@E E$+5XL@E$E XE$P| uChL@hJhhL@ Ph[@8@ @^@@jE$DTFLhEPE@ u?huu uFfE EEMQ MfAxL@GwENFENE FHE$FP3E3EEEEE E̋EEhu vLF,P EPF,PA tuF,PF0PFD;}NEhhh }@ @^@@%EPh~f3覀 _^[ t V| t W|+_^[US]h`"h`"Suuuu ub [USVW]sDžTDžX~,vDWGPFLfE PWGP t W3@ P tuWU u F _^[WGPEvFPhuvL6;Et@^@F$F _^[Ã} u}$u F _^[Í@MEEEEhEP{=\L@L=\L@ʸL DEMЖѹFPhhEPh@tqFTFXX@B|TX⋅T;E T;E uX;E$F _^[Ã=@^@K@^@F$F _^[Ë=\L@L=\L@ʸL#D fEEPEPhvPFTP6E}} =@^@tɃ}}"=@^@6@^@F$F _^[Ã}FLNT;thuFTP\PltP\PBPtmF PtP~ u>EP3@ P uF F$}t2EPW3@ P  t F F _^[VWD$ PD$r _^USVEXs,uVU ^[ÉfUSEXC0xt C,PC0PS~xusx[ÐUu u t&} tdE E@=L@M+øÉUu}PÉUSVWEEȋ=M@UEEȋ=M@}} EQE=M@@E=M@=M@ @ƹ<5$@p=M@4@ FWfl=M@ ul=M@  ul=M@  tnm+Fƍl=M@ ul=M@  ul=M@  tnm;UkF }bFl=M@ uFl=M@  uFl=M@  tnm |50@߉=8@l=M@ ul=M@  ul=M@  tnmnu  M@+ M@+F;M@} M@C(@5,@<@@_^[ÉUSVW5@=@=@uE@@E+@EEPB @@ѹ @@=@)CE t u={W}w`/{Jt{KuC4LM@CtEà ~<0|9~,-t$:t+t,t GF E 4`@lZ؃}9E `@CÃ}CM `@ |E `@@_^[ÉUDSVW} ]E@hM@hM@EP} uEP"ff ftfutSECÍuCFƊ t,t/uEPjT+E؉}w@l@h@YE@E@ usE@EP!EЋ@ECÍuCFƊ t.t/u u_^[EPSEEE;EEM@}}EЋ@l=M@ uEЋ@l=M@  uEЋ@l=M@  tnmnuEM@E@=M@UEM@E=M@UEE;E8?~CÍuCFƊ t.t/u u_^[EPRECÍuCFƊ t.t/t,uEPBRE̋E;E} E+EE+E̹+EEċE;E}!Eč AE̋M;M@|_^[ u_^[,uC_^[CfftfuCÍuCFƊ t,uuEP,uCË_^[ÉVW|$T$t$T$f |$BF  u |ۋBD$_^Ð>oø&oÐoÐnÐnÐnÐUSu PuY [ÐUSVW=@5@=p@w=d@HP@@]hhh@S@ hd@Shp@SSCP@Cxt SCPd@_^[U5@h@u E @P fÉ+ÐfUSV] uSV& t3CPV t"CPV tC PV^[+^[ÉUSVu ]VS thFPFPS^[+^[fUSVu ]VS u+^[ÍFPS^[USVu ]VS u+^[ÍF PS[ u+^[ËF tu8tvSV^[ÍFPS u+^[ÍFPS^[ø^[ÐUSVu ]VS u+^[Ë tu;t(FPS u+^[ÍFPS^[ÍFPS^[+^[ÐUSVu ]VSv t6FPSq t%~uhhP@F PFPSP^[+^[fUSVu ]FF;uRVS  tDFPS t3FPS t"F PS tFPS^[+^[ÉT$L$ |61$P@    AQfL$T$ƒt uAQÐUSVu ]C tu.t{u ^[VsBVs  CFt tu(tCFCF^[ËCF^[ËCFC F^[ÉÉU tu u<u uÉU tu uXu uÉUS];uu SCP[Ã;uu SC[Ã;u[+[ÉUS];uu SC[Ã;uu SCP[Ã;u[+[ÉUS] t t!uLtBE EEPSCP[ÍEPSC u+[ËE fMf[ø[+[ÐUS] t t!uLtBE EEPSCP[ÍEPSC u+[ËE fMf[ø[+[ÐUE EEPu5 u+ËE MfUE EEPu% u+ËE MfUS] t t,uatWE 8t+EEPSCP[ÍEPSC u+[Ã}u+M [ø[+[U tu u+ tu u+ tu u+fUSVWu] u _^[Ë+5 Q@ v +Nj;ufEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMffEEhEPuLX + EEȡQ@ tEȊ@EҋEȊEӋEfMfQ@ tEȊ@EҋEȊ@EӋEfMfHQ@ tt?tU}EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HNEf@fE̋Ef@fE΋EȋM̉H-EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HE t+Q@ tEEҊEEӍEfMfE+ ~Q@ tutt-uftBbEE̊EE͊EEΊEEύEfMf>fEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMf]؉uEfEEhEPuRV  ẺEQ@ tE@EʋEEˋEfMfQ@ tE@EʋE@EˋEfMfHQ@ tt?tU}E@EċE@EŋE@EƋE@ENjEMĉHNEf@fEċEf@fEƋEMĉH-E@EċE@EŋE@EƋE@ENjEMĉHE+ t+Q@ tE͈EʊËEˍEfMfE+ ~Q@ tutt-uftBbE͈EĊËEŊEψEƊEΈEǍEfMf>fEfEfEfEƍEfMf"EψEĊEΈEŊE͈EƊËEǍEfMfE;EvẺEE̋M؍U̍򗥥EE;EE@؋E@fEfEfEf@fEEk MAMԇ񗥥GNjE@ @;unQEuE_^[fU$SVWh/uoB thQ@u3<_^[hQ@ E u Q@Eh @E uhQ@u;_^[u;@P#O u+_^[u?Eu zhhPa? %Ffft(ftLft(fftTftlCuS>u:uS>u:u[WS>W:^uWSo>Wz::uWSK>WV:C%CCFƀ>hQ@P5:E OE_^[NhQ@u9_^[ÉUSVW} u+_^[W9@PMWV=h:V u C:uCPWU=_^[ÉUSVuK9@PLuS=h_S) u+^[^[ÐUSVh_u u+^[CS8@PDLSV<h.V u+^[^[ÉUSVh.u u+^[CSz8@PKSVP<^[fUS+E @IEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u @[Cà }<@ +[fUS+f <@E@ @IEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tC } E@[US]t{u[s t5hhC@P4N uS[+[+[ÐUSVW}]+L;<@u> }- +ÃP@PC@P8M @Cà } <@u+Jfk Gxt8+&k G@<tk G@4\JFk G@;CËG @;+$k Gxtk GpJCËG @;+%fk Gxtk GpICËG @;ӃwCt wI t w I t WI_^[US] fEhSu"B t[hEPCPK E%u+Q@Q@ tCEEfEfQ@ tCECEfEfCQ@ tCECEfEfCQ@ tCECEfEfCQ@ tCECEfEfC+[fUSVWE m;]s}t } t+_^[SF u+_^[ËC+5Q@EE}| ǃ_^[ÉUu HfT$L$:uËA8u+ÉUS0R@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[ÃÃ84+[fUSVu t u+^[V u V^[S5^[ÉUEPuU SVW]]+EFƋE8t E=u= @FfVS7 u.E=u+ @=S@M EE_^[Ãǃ?u+_^[ÐVT$t$ fF :uB=u^ uF=u^+^ÉSVW|$\$t$;u+_^[f |F :uC u+_^[ }+_^[ +_^[fUSVWu}F u(F% tfN@^@ _^[VWu # F t _^[Ë_^[ÉUSVWEDž Dž@V@؋BV@EƅEu _^[Í^@;`@u?8%u@%t8tr%u@%tSu+, `@D@ + @ u_^[Ë%unf@ u@@ l^@A t̋$u#u u3"u _^[fE8"EE%^@;`@uE8t^E%tSE}tHE8t@E%t5}u+&E `@D@ +@EE벋E+u=E@x}uP=EkE@% t;EM+QM1: M+ uE+Ph?/E@ t _^[Í^@;`@uE+ERE+u+D u+3 `@D@ `@I;@;E++E+; u+P u+9 `@D@ `@I;@ } _^[ËE+;aEEE8)Dž EE@ u@@ l^@A t̋$u$u% @E+EEEȉẺEЉEԉEfEff=B|ft0fu6t6ff |+f=%$T@EEEE E=;}u+&E `@D@ +@EE tE*EE@ u@@ l^@A t̋$u%u$E@E E E @E}}PE؉EECEkE OEEE@ u@@ l^@A uƋE.t EEE*EE@ u@@ l^@A t̋$u%u#E싅@ESE E @EDEkE OEEE@ u@@ l^@A uEEfftftftfuEEEEDV@LEH+E܉EEEC|  5x $S@ i U uE E @Mx MhDžDž Dž}}E}t+ uE E @ǃt8tt$t}}.EpV@L tV@L }}E uE E H4H8 4H8,P0PE@}E@P84 ؃,txV@L&}tzV@L}t |V@LP@ u3@@ l^@A tC tFP F tC0}u}t:^@;`@uF.$hd(PV(f>tFEEFC E}~ u卝PS@ܝ4tj0 } ؉ t?fH =S@0H učC;HsHH0H0S@ܝ4 t+-HH=@ǃ u@@ l^@A  tEeH}" P+ȉH"ȋE+E }}E uE E H4H8 4H8,P0P}<}E<P84؃,t,E;0|S@ܝ4u~V@L&}tV@L}t V@LP@ u3@@ l^@A tC tFP 0 Dž$fF ~  u $ t0$$C }u}~7^@;`@uF.!h$PV$>tF}<}E< E+ E܃ |[F00~  u $ t0$$C땍P}s+ËM++M܉M_}} E }uE uE E H4H8 4H8,P0P}}EP84@ u@@ l^@A AS@ܝ4u Dž0E쉅$}uJS ;$} $$|$0u $ۃ0| 0;E~$E$+0ELjPqEă}tg uE E @ PPe7 } _^[ÍP؋  uE E @ @@% u%@=@@% u%@=@@% u%@=@@%S@%R@%Q@%P PP u+@P u+1P `@D@ `@I;@ } _^[Ãu DžP؋}t+EȿsEă} uE E @ }}E쉅}}.`@@$ȉ E쉅8~~u@ t^@;`@ t@P5@PP~4$)E$)s} )E}} #e}uR#E;E f8@ t^@;`@ t@P5@PPg3 } _^[ÍP u+@P u+1P `@D@ `@I;@)E}A+0 uE E X  }}E쉅}}VtE8;u+D u+3 `@D@ `@I;@Eu+, `@D@ + @ A}}S} u+8 u+- `@D@ `@I;@)E}>t7 u+# `@D@ +@ yEO>tIE}|? u+# `@D@ +@ u _^[Ã}}E}}E}ts t+=S@+É E E܉L u+L@ uȍE+Hȉ$}fEE;$E@x}u @P&E @tR@ u+@@ u+1@ `@D@ `@I;@ } _^[EFL E@x}%uLL@PV% ELL@tR@ u+@@ u+1@ `@D@ `@I;@ } _^[E4E}E@x}u0@P$E0@tR@ u+@@ u+1@ `@D@ `@I;@ } _^[EK }(sP 80Sr- } _^[à u+8 u+- `@D@ `@I;@u4E@x}uPD#)EE@% E u+8 u+- `@D@ `@I;@PSE0 u+8 u+- `@D@ `@I;@ȋRu u+8 u+- `@D@ `@I;@PhSE@ t _^[Í^@;`@uH u+8 u+- `@D@ `@I;@E u+8 u+- `@D@ `@I;@ u+8 u+- `@D@ `@I;@;5 u+8 u+- `@D@ `@I;@+ u+H u+5 `@D@ `@I;@ } _^[Ë u+8 u+- `@D@ `@I;@;6EE u.E@x}uPdETE@% t-E SM1_  u hS E@ t _^[Í^@;`@u E u+8 u+- `@D@ `@I;@;  +;  u+H u+5 `@D@ `@I;@ } _^[Ë; pEEE}E@x}u0@PE0@tR@ u+@@ u+1@ `@D@ `@I;@ } _^[EKfH E@x}%uHH@P EHH@tR@ u+@@ u+1@ `@D@ `@I;@ } _^[E4EE;$E@x}u @PBE @tR@ u+@@ u+1@ `@D@ `@I;@ } _^[EFE_^[ÉU(SVW]+uEE=E}fEfEf fEm]m̋EĉE0Em W@];rF5|0@;u@1}tG09@_^[É(SVWD$8D$D$s P@pPhhP@s P@~hhhP@r P@`hhhP@r P@BhhhP@r P@$hShP@r P@ P@=P@u &X@[áP@[ÉUSV] u^[Ã} uSȋ^[É`@@PSEPT |DE ;Eu^[ u+# `@D@ +@ t;u+^[ÐUSVW}t} u _^[ËE  uE+_^[á`@0:^:^F tcuLE @:FE @:F }} _^[M I M_^[ËM_^[ÃuTE @N+N+|tP}} _^[M I M_^[N+|tËM_^[Ë6 _^[SVt$ u+^[+~ u+8 u+- `@D@ `@I;@ ^[ u+# `@D@ +@CÀ>{^[ÉVL$ u+^Íq8t+ƙ=Z@^fUSVW]} C @;}k C@;EEk KI4~Ek KI<Ek KIEMVBR MUE u Z@_^[hvsV shF@Put Z@_^[ËE_^[ËEk KI_^[ÍZ@_^[fUSVW]fcC }}i{tcC uXs} }uhhCPD +)u C% u ~;C+; ;){+_^[C% t Cfcuu CP CuC% tYSC% tCfcC tuu CP &uu CPx @^@ u _^[+_^[USVW]} ~}+_^[ËE m{-SuE +u M+ȋ_^[ÃC;ssCW3u ljE){;C +E{}+CM;~ S+ xE_^[USVW]E {u S C u(C% tfK@^@ _^[CD t]E?fE<^@ǀ4^@;sF@ t V+ ;rEE;E} E<^@uCC tC +CPsCP CC{| _^[Ã{tfK fKC% tfcC_^[fUVW}u MIft3ft,ftftIt(ftft rftE_^]ÐJ ÐUSVW]E EDE<^@ǀ4^@;s&F;uF t V ;rEE;E} E<^@u_^[ÉUSV] u^[C% t:C t+ S[CP0  }@^@ C tsOCfCCC^[ÐUSV]C u/S |hVCP C+^[ÉC u#C t{t;Cv S{C t ^[+^[USV]u FRBu>;F à t^[Vu ^[^[Fu:F]hEPFP u^[fN ^[Fu~ u);Fu~ t FD   t V<+ t ^[FD VCF~}VP F t ^[^[fUSVW]{+ljE;CD t+C +CCC +E{}+CM;~,]Ëˋ@ + } EȋI E;p}EpE}~DfuEPCP E~E)EEE}fK _^[+_^[USVW]Ct/C% u@^@ _^[CfC{u S];CuLCD uAC +CCC +E{}+CM;~G + }G ;w}w+_^[USV]sC t hCfKCC ]}4^@CC DhC tfKCC hCfKCC CVQ tC ufK@^[ÉD$L$@ + }D$L$I ËD$;P}D$PÉUS@^@EPhTu } @^@+[ø[USVW=@uxU@h؍GO#+‹ }@ tWlu+_^[+E@;EveFơ@;Ew5@@;ErE+@E5@E;Es fe}u+_^[FƋE;ErT@ uV.T@ u+_^[ËT@ƈCC_^[USVWEȸ ~V;5@}=@ǙE=@EWQ؃tET@E}~ _^[f|$uËD$tAЋT@ T@USVWE}uu _^[ËEu EG.hW }5`@W }Fȸ;@s @؃}tF t%Fȸ;5@} @;] r ;u sE_^[uu EE u+_^[ËE;Et;] vE Puu4 E_^[ÐW+Ƀ}-+T@;T$u_GNj t;|$ uA|Ӹ_USVWu~}FF t F؋HF% t'+F t.~t(F u+F@^@ _^[+ ~(hhFP u _^[Ëǃ thhFPO hhFP4 |_^[ÉUVWu} Mq;w$g;r-NOIft3ft,ftftIt(ftft rft_^]Ð>ÐL$ <^@(@r[L$r <^@ <^@ã@^@ËL$(@r&r <^@ã@^@@^@ÐVÐBø*ÐÐ6Ð@^@ÐVWT$t$ t u+_^á`@x f;w;w vG tLG t*G%BO_^ËG%_^Ë+GD$G t#>#>#>#>#>#>#:#.#2#>#>#6#@(#)buffer.c 16.4.1.3 LCCbuffer header %3d out of range b%4d b_forw%s=x%.8p %*.*sb_back%s=x%.8p %*.*sav_forw%s=x%.8p %*.*sav_back%s=x%.8pbhaddr%s=x%.8p %*.*sprocp%s=x%.8p %*.*sproc%s=-1%d %*.*serr%s=%ddev%s=%lx %*.*scnt%s=%u %*.*saddr%s=x%.8p %*.*sblkno%s=%ldsite%s=%d %*.*slpgno%s=%ld %*.*sislot%s=%d %*.*sresid%s=%u flags(x%lx)="readwrite%s xlock slock downgrade done yyy error phys hole want age async delwri cache inval locked head netib bad" Buffer hash element %d out of range bh %4d addr=x%p flags=x%.8lx forw=x%p back=x%p ---> x%p Buffer queue out of range %d ---> x%p BUFFER %d: out of rangein i#: %ld md: v-g-u-%s%s%s%3o ln: %u uid: %u gid: %u sz: %ld maj: %d min: %1.1o a%d: %p at: %smt: %sct: %ssbflag=%x4.4x, uniqid=%d, flag=x%4.4x, fstore=%d, version=%4d, cmtcnt=%4ddir d%2d: %5lu unprintable: %.14swrbuf.creat errorwrite errorfile: %s su name: %-6.6s pack: %-6.6s blocks: %6lu inodes: %5lu free blocks: %6lu free inodes: %5lu fmod: x%2.2x ronly: x%2.2x time: %sdinfo: x%4.4x flock: x%8.8x ilock: x%8.8x %d free blocks in list: %5d%s %d free inodes in list: %5ld%s magic=x%x, gfs=%3d, lwm=%4d, hwm=%4d, llst=%4d fstore=%6d, gfspack=%6d, ninode=%6d, version=%6d FREE BLOCK LIST for REPLICATED FILSYS: %p COMMIT Counts: %6d @(#)klist.c 16.2 LCC@@@@@@@@@ @ @ @$@&@0@6@8@>@B@D@J@L@ V@ Z@\@ f@ j@l@ p@ r@ t@ |@ @ @ %%%%%e'%%e'&&(%6(@(#)misc.c 16.3.1.2 LCCinvalid modeMemory from Pid %5d %p: %12.12o %12dMemory from Pid %5d %p: %6.6o %6dMemory from Pid %5d %p: x%2.2xMemory from Pid %5d %p: %8.8xerror: %s error: %s decimaldeceoctaloctodirectorydirectdirsuperblocksblkwritewcharactercharcinodeinoibytebshortdecsddshortoctsoohexhxhexadechexadecimalstrs@(#)swap.c 16.5 LCC/dev/swap/dev/dumpSopen: file %s already open! SopenSopen: Unable to open %s swapread: Swap file not open! swapread: Invalid request dbdoffset %d, count %d swapreadswapreadError reading swap file dumpread: dump file not open! dumpread: Invalid request offset %d, count %d dumpreaddumpreadError reading dump file Sclose: file not open! Sclose@(#)user.c 16.2.1.4 LCCgetupages: Can't read upage%s from core for proc %d @(#)vmread.c 16.2.2.1 LCCvmopen: can't handle dump with mem/kmem vmopen: can't open %s: %s vmopen: can't open %s: %s vmopen: can't open %s: %s vmreadtab: cannot malloc %u bytes (errno 0)system error %d%s: %s: vaddr = %p, seekoff = 0x%lx %s: %s: seekoff = 0x%lx %s: %s: cnt %d, ret %d %s: failed read was at vaddr %p, offset 0x%lx %s: failed read was at offset 0x%lx pmread: read errorpmread: seek errorpmread: read errorvminit: dump header read errorvminit: %s is not a 386 kernel core dump vminit: mismatched versions of dump header: %s=%u, vminit=%u. vminit: malloc of %d bytes failed for dumpmap vminit: pagedir seek errorvminit: pagedir read errorptod: Physical address %lx was not dumped. @(#)nlist.c 1.11 AIX@(#)dup2.c 1.8 AIX@(#)getpasswd.c 1.35.1.9 AIX@setpwent: getdomainname system call missing system.catrgetpwent: getdomainname system call missing r+**++passwd.bynamepasswd.bynamepasswd.byname%dpasswd.byuidr/etc/sitegroup/etc/passwd@(#)NLflatstr.c 1.10 AIXCueaaaaceeeiiiAAEaAooouuyOUo#OxfaiounNxo?r~??!<>###||AAAc||++cY++--|-+aA++--|-+*dDEEEiIII++##|I#OBOOoOmIIUUUyY?'-?_???%,o".132##????????????????????????????????.??HDCS@@OO????*><^!??#-^v>/+<>???????????????????????????????????><+#v^|?<>?%'?u??+Lx"=yelhi((%&kwnorgq))~xcuz||0123456789|?YPL?b?~?????X?DU~~04567890P~||++++||---++++++##abG?SstFQOd8fEn=????=o?-n?-?uvo)@(#)putpwent.c 1.8 AIX%s:%s,%s:%u:%u:%s/%u;%s:%s:%s @(#) getnetgr.c @(#)getnetgr.c 1.10 1.10 LCCgetnetgrent: getdomainname system call missing Cycle detected in /etc/netgroup: %s. lib.cat # syntax error in /etc/netgroup --- %s netgroup@(#) innetgr.c @(#)innetgr.c 1.8 1.8 LCCinnetgr: getdomainname system call missing lib.catnetgroup.byusernetgroup.byhostinnetgr: recursive overflow lib.catnetgroupinnetgr: netgroup %s called recursively lib.catinnetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup # *@(#)sfnum.c 1.8 AIX@(#)sfent.c 1.14 AIX @ @ @ @ @!@/etc/site/etc/sitevaxi370xa370x286i386romp@(#)NLstrncpy.c 1.9 AIX@(#)cuexit.c 1.8 AIX@(#)rew.c 1.7 AIX@(#) yp_enum.c 1.2 LCCYP_@(#)bcmp.c 1.1 AIX@(#) yp_match.c 1.2 LCC@(#)yp_bind.c 1.3 AIXload_dom_binding: malloc failure. system.cat@(#)sleep.c 1.19 AIX@(#)sigdelset.c 1.3 AIX@(#)sigfillset.c 1.3 AIX@(#)sigmptyset.c 1.1 AIX@(#)sigismemb.c 1.3 AIX   @(#) ypprot_err.c 1.2 LCCTċ@(#) ypv1_xdr.c 1.2 LCC0`@(#) ypxdr.c 1.2 LCC@(#)printf.c 1.8 AIX@(#) stat.c 1.2 LCC@(#)mbtowc.c 1.4 AIX@(#)wcsncpy.c 1.1 AIX@(#)catgets.c 1.1 AIX@(#)setlocale.c 1.19 AIX%m/%d/%y%h %d %Y%a %h %d %H:%M:%S %Z %YCSunday:Monday:Tuesday:Wednesday:Thursday:Friday:SaturdaySun:Mon:Tue:Wed:Thu:Fri:SatJanuary:February:March:April:May:June:July:August:September:October:November:DecemberJan:Feb:Mar:Apr:May:Jun:Jul:Aug:Sep:Oct:Nov:Dec%H:%M:%SAMPM-.:,at:each:every:on:through:am:pm:zulu.:,:3:$:$:.:,:3:+:-:2:2:1:0:1:0::1:1now:yesterday:tomorrow:noon:midnight:next:weekdays:weekend:todayno:n:Nyes:y:YCCCC.eb.cctC.eb.cctsetlocale: Unable to open %s file "%s" 5@5@5@5@5@5@5@5@ 5@ 5@ 5@ 5@ 5@5@6@ 6@6@6@(6@26@86@B6@L6@T6@\6@d6@l6@v6@6@6@6@ 6@ $@ $@ $@ 0$@ 4$@p$@$@$@%@ %@$%@(%@,%@0%@T%@|%@%@%@%@%@%@%@ %@ $@ $@ $@ 0$@ 4$@p$@$@$@%@ %@$%@(%@,%@0%@T%@|%@%@%@%@%@%@%@ %@     H*@*@*@*@*@*@+@CCCC.en.enrconfigurationsetlocaleLANGCLANGCOut of memory Out of memory Ccollationsetlocaleread errorsetlocale: bad magic number for ctab file "%s" lseekmallocread errorread errorread errorsetlocale read errorsetlocale lseekmallocsetlocale lseeksetlocale read errorCcollationsetlocaleread error:setlocale: bad magic number for ctab file "%s" mallocread errorC.cct.cctconversionsetlocaleMBCS_CFG_DIR/usr/lib/mbcs//  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~LANGLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGELOCFILEMBDATEMBLANGMBLDATEMBLDATIMMBLDAYMBSDAYMBLMONTHMBSMONTHMBTIMEMBAM_STRMBPM_STRLANGMBCURSYMMBNUMSEPMBTMISCMBMONEYMBTSTRSMBNOSTRMBYESSTRMBCOLTABMBCTYPEMBCONVTMBNLINMBNLOUT@(#)memcmp.c 1.7 AIX@(#)perror.c 1.15 AIXError %d occurred.: D@<9@D9@h;@X<@8=@T>@|?@@@A@B@\9@D:@:@:@;@;@,;@<;@H;@X;@;@;@;@;@;@;@<@ <@0<@H<@h<@<@<@<@<@<@<@<@ =@(=@T=@d=@=@=@=@=@=@>@>@@>@h>@>@>@>@>@>@?@(?@H?@h?@?@?@?@?@@@(@@H@@l@@@@@@@@@@A@(A@DA@`A@|A@A@A@A@A@B@B@(B@4B@@B@TB@hB@|B@B@B@B@ C@8C@DC@dC@C@C@C@C@p9@9@9@9@9@9@:@ :@,:@8:@h:@t:@:@:@:@:@:@:@:@:@x@(#)strcat.c 1.8 AIX@(#)strdup.c 1.3 AIX@(#)errlstvals.c 1.1 AIXbas2.catlib.catsystem.catError 0Operation not permittedNo child processesOperation restricted to local siteLock conflictMiscellaneous system table fullInvalid mount operation requestedError 104Undefined journal operationPack is busyError 107Error 108Error 109Resource temporarily unavailableError 110Error 111Error 112Error 113Error 114Error 115Error 116Error 117Error 118Error 119Not enough spacePermission deniedBad addressBlock device requiredResource busyFile existsImproper linkNo such deviceNo such file or directoryNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate I/O control operationText file busyFile too largeNo space left on deviceInvalid seekNo such processRead-only file systemToo many linksBroken pipeDomain errorResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedInterrupted function callLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedOperation would cause a deadlockDevice not readyWrite-protected mediaUnformatted or incompatible mediaNo locks available.Input/Output errorCannot Establish ConnectionConnection DownMissing file or filesystemRequests blocked by AdministratorOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longNo such device or addressProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddr not supprtd by protocol familyAddress already in useCan't assign requested addressNetwork is downArg list too longNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownConnection timed outConnection refusedExec format errorHost is downNo route to hostError 82Error 83Error 84Symbolic link loopFile name too longDirectory not emptyDisk quota exceededShared library cannot be accessedBad file numberShared library format is bad.lib section in executable is corruptedLinking more shared libraries than allowedError 93Required site is not availableOperation terminated because of site failureFile or working directory is unavailableNot a local deviceBad site specificationLoad module not for this machine type9@=<9@(9@D9@(9@h;@(9@X<@(9@W8=@09@T>@(9@~|?@9@c@@(9@ A@9@=B@(9@v\9@9@=D:@9@=:@9@=:@9@=;@9@=;@(9@,;@(9@ <;@(9@NH;@(9@~X;@9@=;@9@=;@(9@ $;@(9@;@(9@;@9@=;@(9@<@(9@  <@(9@}0<@9@=~H<@(9@h<@(9@<@9@<@(9@=<@(9@<@(9@x<@(9@L<@(9@(<@(9@_ =@(9@`(=@(9@aT=@(9@bd=@(9@=@(9@w=@(9@^=@(9@=@(9@;=@(9@>@(9@>@09@)@>@(9@#h>@(9@/>@09@E>@(9@>@9@=>@(9@>@(9@?@9@=(?@(9@:H?@(9@fh?@(9@?@(9@?@(9@?@9@=?@(9@@@(9@(@@(9@ H@@(9@l@@(9@@@(9@o@@(9@p@@(9@n@@(9@A@(9@1(A@9@=DA@9@=`A@9@=|A@(9@!A@(9@2A@(9@0A@(9@KA@(9@{B@09@C B@09@C (B@09@C 4B@(9@@B@9@!TB@9@=hB@(9@<|B@(9@B@(9@B@(9@B@(9@c C@09@C 8C@(9@DC@(9@dC@09@DQC@(9@C@9@=C@(9@dC@(9@p9@9@=9@(9@i9@09@#9@09@C9@(9@9@(9@:@09@C :@09@C,:@8:@h:@t:@:@:@:@:@:@:@:@:@@(#)sprintf.c 1.6 AIX@(#)flushfd.c 1.5 AIX@(#)fgets.c 1.12 AIX@(#)memccpy.c 1.7 AIX@(#)mbgettab.c 1.6 AIXMB1ؿܿܿؿؿ@(#)flip.c 1.10 AIX@(#)strrchr.c 1.7 AIX @(#)clnt_udp.c 1.8 AIX\ 8`clntudp_create: out of memory system.catclntudp_create: out of memory system.cat<@(#) gettimeday.c 1.2 LCC@(#)ctime.c 1.23 AIXM:/Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZ02:00:00%sd<Qd dCUT@(#)strncpy.c 1.7 AIX@(#)bzero.c 1.1 AIX@(#)auth_none.c 1.4 LCC $@(#)pmap_prot.c 1.2 LCC@(#)rpc_prot.c 1.4 LCCl@(#)xdr.c 1.8 LCCxdr_bytes: out of memory xdr_string: out of memory @(#)xdr_mem.c 1.5 LCCL(@(#)flipnet.c 1.5 AIX@(#)NLgetamsg.c 1.1 AIX@(#)catopen.c 1.13 AIXCatopen: Unable to malloc memory.rNLSPATH/usr/lib/mbcs/msg/%L/%N:%Nrrr@(#)calloc.c 1.11 AIX@(#)strchr.c 1.7 AIX@(#)NLgetenv.c 1.22 AIX R@ R@ R@ R@ R@S@ S@S@S@&S@.S@6S@@S@JS@RS@ZS@bS@hS@pS@xS@NLDATENLLANGNLLDATENLLDATIMNLLDAYNLSDAYNLLMONTHNLSMONTHNLTIMEAM_STRPM_STRNLCURSYMNLNUMSEPNLTMISCNLMONEYNLTSTRSNOSTRYESSTRNLCTABLANG@(#)getenv.c 1.8.1.1 AIX@(#)strncmp.c 1.7 AIX@(#)fprintf.c 1.9 AIX s f yf  f f f f f f f f f f f n f f f f Hf f f f f f f f f f v 0ys f 0f f f f <Hf f  f 0f f HRaaWaaaaaaaHaMaa\$$$$$$$$)$$D$$$$$$$$$\$B##.##.############p#####"##########E#".#.#.##"#####"###s##"##"@(#)doprnt.c 1.31 AIX-+ 0123456789ABCDEF0123456789abcdef0x0X-+ -+ @(#)atoi.c 1.9 AIX@(#)ecvt.c 1.10.1.3 AIXnF nF 7yACחA@Y@$@QNaNSNaNINF?$@@C1&&G&&&&]&&&&&&&&T&&&&q&&&&h&@(#)strlen.c 1.7 AIX@(#)fopen.c 1.11 AIX@(#)findiop.c 1.9 AIX@(#)fwrite.c 1.9 AIX@(#)memchr.c 1.7 AIX@(#)nl_langinfo.c 1.3 AIX00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000[.|..../////// / / / / / / /@/@/@/@/@/@/@/@/@/@/@/@/`/`/`/`/`/`/`/`/`/`/`/`//////@(#)mbschr.c 1.3 AIX@(#)mbstomb.c 1.3 AIX@(#)mbslen.c 1.1 AIX@(#)wcslen.c 1.1 AIX@(#)dordmsg.c 1.1 AIX@(#)fseek.c 1.12 AIX@(#)fread.c 1.10 AIX@(#)filbuf.c 1.9 AIX@(#)flsbuf.c 1.12.1.4 AIX@(#)isatty.c 1.7 AIX@(#)malloc.c 1.19 AIX@(#)ftell.c 1.9 AIX@@@[@@@(@@(#)wctomb.c 1.1 AIX x/@|1@T-@T-@X/@$-@<-@?MB1C^@^@@(#)cleanup.c 1.1 AIXN@O@dd@(#)mktime.c 1.2.1.3 AIXM:/;Zx0N@(#) pmap_port.c 1.1 LCC<@(#)_cleanup.c 1.3 AIXIX kh.mB:;++䯄-$B%./usr/bin/ticru+ }H(P@.text .data@@}@.bss@@H(ÐUSVWh@蓁 V@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tPh@h+0 t:+'4@fV*tƃ>uCÃ<@u_^[ÐUSV]s 3ssH t4s {t%{tC0sPVsp +^[ø^[ÉUSuD u%hu`؃u+[Suuu Sw-[ÐUS+;@f@@MEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u @[C;@'+[É=@1uË@@L$ @+fUS+;@}4@pC;@|@[ÐUSVW+;@}phVؾt } |BV@@@Pt%@@@PA@@fpC;@|_^[U=@u;h@@h@Ð SVWt$ \$D$ i u+< u+1 h@D h@I; h@D|$ D$$;D$ |ǃ t CF D$ ;D$$}>u_^[ É:ET@RU RP^]-@ P-@NjUSVW}u ht@f~fF-u[Ff@fu"FxtF@Уp@'p@h@h}@]hǃh@grl@uh@hT}@G-;}$4h @4rPC;|h[_^[fU@SVW}uu N_^[ƅ@PPfuh PP u0u-u v tP +_^[#t tP,u C\uCC|@ u|@@ 8@A  u!tu  PHQ3ȁ |15@ht}@TPh"@ht}@; |@ u|@@ 8@A tCSPlP4_^[fU SVWƅh&@upu _^[ËE@Puh PN u4#u L tu]_^[+_^[#tP,u C\uCC|@ u|@@ 8@A  u E8tu  uNQ9ȁ |,h(@ht}@[uhB@ht}@F |@ u|@@ 8@A tCSuu _^[ÉU(@SVW@@@=@ ~ 5@5@ht}@ +_^[huSl u@_^[ÉCsuCeuC=uhCPEP h,EPMl tuEPP. t6hF@EPP tEP5@*+_^[ËGǀ?t,u?tGNjG|@ u|@@ 8@A u׃WPh,Pk uCSUhNk؍PS0t_^[f @#u+fT$AB€:t:t u|t,t uf9t,t |tA t,u+AÉT$:t ,tB uB|@ u|@@ 8@A u,uB͋ÉUSVW=@u EEWz u _^[uWu uыE@u _^[#t=uG-u EGǾ 0u+ې|@ u'|@@ 8@A tދG]_^[fUSV@u S؀;u+^[VuS uހ;t,u ^[@u+^[fUSV@uq S6؀;u+^[VSu` u@u+^[=uCu S ^[ÉSVW\$$D$(0C ,ǃtCV@D$CD$D$;uD$D$D$D$8tЉ=|@ǃ uu|@@ 8@A t^D$ |@ u|@@ 8@A  uC D$ |$ u uFψFD$(D$(0_^[ÉU$SVWEE8fE8tE,tEEP P E,8t|t,uӋ8t=l@t+5l@PZ hr@P ht@P0 PP6 }PC_^[Ë0x@PP PN=p@tP5@h@P\g\uPvC_^[\hP@X\Xh @T\T\h@jP\h@NPu\hb;f\@x}\Pq\CÀ;uË\@x}\h3\+=d@ @Ek7\@x}\Pߦ\ƈ=p@~VE075@ǃEE8uTX t6\@x}\hf\+=@@EFf7-\V=p@~VE0754@uǃEE8ud`=@@EP7 ؃=p@~1 tSE075L@ E075d@ t8\d`+Q)``C  t\hǃEE8O\d`+QhdPhh \i \d`+Q5x@P\聣@8A+8|@ u|@@ 8@A t8t|t,u8t `=l@t+5l@dP h@dPh@dPdPdP;dPP=p@dPP5|@ _^[fUSVu ]tnF~}V%PˁF~}V%Pݢ^[Ë^[ÃF~}Vh詢 F~}Vh脢^[Ë^[ÉT$+ɉ:t AÉUSVW}/uCÀ;u+ƃ^FP@P>EPWJ  }PWh@P =p@tPh@4P5x@WC/@PSFP5@EPW  |,E;t@}!=p@~W5@W_ _^[fT$JB t+fUS]SC[ÐUS]Sd[ÐUSVWu}F uF% tfN _^[VWu Mj F t _^[Ë_^[USVu }@ u#}@% t f }@ ^[ht}@Vui }@ t ^[Ë^[fU$SVEEE܉EfEuEPVu i ؋E^[ÐUSVWhhhhuh@h@h@ } _^[hhhhhEPW EShVh}uE_^[ËE_^[ÉU SVW] {ufCfE{sWEPVu _^[ÐUuuu5@u u Ð_ÐVÐnBÐ .øÐUSVWu} hV |;u_^[W葧WhV֦ }= @u  @ _^[fUSV]u VS ^[fUSV]u VS ^[fUSV]u VS ^[fUSV]u VS ^[fU(SVW];;E r+_^[áh@@PW t->;E s"h@@P3EP 3E_^[EE_^[ÐU$SVWE;E u+_^[+EE+}}EEEEE E܉}u\uEP>E|@ u|@5|@ @ @@A }\EPEPS ؃uDEE|@ u|@5|@S @ @@AE8uE}u\u܍E PE|@ u|@5|@ @ @@A }\EPE PVb uDEE|@ u|@5|@@ @@4AE8uE uE+E}t}t;;t +_^[Ë_^[U(SVWE;E u+_^[+EE+}}EEEEE E܃}ugE;Er+EEE؋ȋE|@ u|@5|@@ @@A }\EPEPSI ؃uDEE|@ u|@5|@@ @@AE8uE}ugE ;Er+E E E؋ȋE|@ u|@5|@"@ @@A }\EPE PV uDEE|@ u|@5|@@ @@4AE8uE uE+E}t}t;~;t +_^[Ë_^[ÉUuu uÐUuu u/ ÐSVW|$(\$ t$$\$ t u +_^[D$$f|$ ~lD$ D$ ~ CF  u+8 u+- h@D|@ h@I;|@D$ D$ D$;|$}+D$;}D$_^[ÐUSVW}]u WVS _^[ÐU(SVW] u @_^[ÍEPu}॥E EE t tueEPEPS u _^[SEP0hEPh u _^[ËE_^[VWT$ t$ t |?~ @_^ÃƍB <θ +_^UHuÉÐWT$ u @_Jy;s;r+_Ðd#ÃÐø j|$tT$Uhhdu uÉUhhdu ulÉUhhdu uhÉUhhdu u4ÉUu hxuu2Uu hxuuøøø zøb|$tPD$ XÐUSVW} t E  u+_^[ËE h@0f:^:^F t]ǃu:E x:~:~ }F M}F M|ǃuBE x:~rQ:~ wL}tZN+NV+AN+MD.}t(N+MD6 _^[;}~ _^[Ë_^[ÉVWT$ t$ t u_^ËfB8tBF  t_^fVWT$ t$ t u_^ËfBF  t_^fVWT$ t$ t u_^fƒ8tfƒ΃  t_^fVWT$ t$ t u_^fƒ΃  t_^fVW|$T$t$T$ t u_^f |)ƒ΃  u吃 |ۋƒD$_^USVWE% u E%_^[ËE%؋E%E%|#Ci@ƃ u |AFG0u |~FG |~Ci@ƃc_^[à u!|F=_^[Ã/|$~ |~Ck_@ƃ _^[;=,@| _^[Ë_^[U$SVWE 0T@EP葕EuE 0WA }W_^[ËEE}E؃Ek@EE@EEf8u4E E܋M 1M܉  @_^[ËE@؋EfxuEEEf;uREE;E;E E܋M 1M܉ u @_^[EE;E~ŋE_^[Eƃ˃;tEWەE_^[ÃVWD$(D$ D$|$ D$ ؃D$ D$ k@GD$f?u D$$U@fuD$(D$3D$$0:uD$$0D$_^Ëƃʃ;tۃ딋D$_^ÉU$SVW @E 0sR@EPKuE 0W }Wǔ_^[ËEEE}E؃Ek@EE@EEf8u4E E܋M 19M܉  @_^[ËE@؋EfxuEEEf;uREE;E;E E܋M 1M܉ u @_^[EE;E~ŋE_^[Eƃ˃;tEW蓓E_^[ÃVWD$(D$ D$|$ D$ ؃D$ D$ k@GD$f?u D$$U@fuD$(D$3D$$0:uD$$0D$_^Ëƃʃ;tۃ딋D$_^ÉUSVWu t} u _^[ËEȉML@;h@u?E 8t;usƃM E  ;us+E=!@E_^[ÉE  ;uh@8 :_:_G t8Gu"E @8:r{: wvG |G rGu=E @8:rC: w>GO+@EO+mO+D)O+D? G u _^[GE ;us+E=!@E_^[ÉUS}u+[áh@@Pu +[ËE[ÐVWD$|$ t D$  u+_^ËD$ h@0 :V:VF t8ǃu"D$ @:Fr D$ @:F wD$kD$aUǃu1D$ @N+N+|t$D$$N+|t D$ 6 JD$;D$$ D$_^ø_^fUSVW]5 @t{u5 @E_^[Ã{u S4؃u5 @E_^[Ã;teC @;E rHE k C@;Ev6EM k KI|t 5 @EM k KID_^[É5 @""@_^[uu S:M t?t 5 @_^[É5 @E_^[ÐUSVu] uVSh5@ISh9@;Sh=@-ShA@ShE@ShI@Sƍ -@PhI@hE@hA@h=@h9@h5@hQ@h)@R u )@^[Ëƍ -@^[fUSVW]u |~+_^[VhM@^ u&u )@_^[ËÍ -@_^[ uS _^[VQ@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uSSg_^[CuRF@uGSSFPh thS S _^[DžGF  t"G@uGSVh9 PS% t+_^[S_^[ÐUHSVW] heu _^[ËE tD}tExuE@E}u担MH EHE$ȉH @@EЍEԉEE+ɈEǃt t4EEC  E@=uߋE@ u+8 u+- h@D|@ h@I;|@;EMQ!Q Ah艈Axu _^[Ë@H @EЍEԉEE+ɈECh u+8 u+- h@D|@ h@I;|@ +_^[fƃ ~EEЋC  uYEMQQA@D;uE輈+_^[览@t _^[Ë_^[US] t+{t[;[ t[ sPSE[fT$ t;D$uD$ Bà ƒ8u+fUS$@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[à Ã84+[fT$+ t;D$uËA ƒ8uÉT$ t;D$uBà ƒ8u+fUSVW+ۋCM )@4 Vh'@ |k f<'@tk 4'@菆ƃt tu-thQ@ hQ@ hQ@5k f'@Vhx&@2PVh'@ G_^[ÉUSVW]} tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv  ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u6v1 u56?Ek f'@Ek N '@v  t26vv uup_^[u[+_^[ÐU SVW} t E  u+_^[hu PPwPuPuVR@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ thR@PhR@P9 u5Ph R@hd$@h}@?9hR@_^[+ߐVhP6 tQ t#tЍP,tƄEuPS V y_^[ÉU SVW}Eh"R@BE tE8u (R@EWP uhB u0WCPh( PhS1+_^[fEk $@E 3uh$@PzAE E8EMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tBuu u0WCPh Ph<S}+_^[ES}W>_^[Wh$@E u+_^[u"@ t uh*R@@ t uh0R@WM_^[VW>_^[ÉUSVW]u }| t u+_^[Ã}fE\uFR:uJ u+8 u+- h@D|@ h@I;|@uF5 u+# h@D|@ +|@ l u+_^[Ã}SfCF  ts\u CF :uJ u+8 u+- h@D|@ h@I;|@uC_^[USVuu h'@ u+^[Ã}}SV'r^[uSVT u+^[Ë^[fU SVW+ۋfE)@< t[Wh$@\EWh'@KE}t}uFu\oEuNoMȃF딃Ek $@EEk $@ u)SIyE uEh2R@h}@3+_^[SuzE uhBR@h}@3+_^[ËEk f$@Ek M $@+E@E@E@EE)@< Wh$@<EWh'@+E}t}uFuu}pu.nEEE=uuXpu nEEE;FfEEhM@u_^[À=@u =@ u f=@t @ fU$SVWEEVRR@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u T@;@@tB+_^[hhu P3E }?hu PhTR@hd$@h}@)1h^R@ _^[hh@u: t"hhR@ u{_^[B tOhtR@h}@0huO PhR@h}@0 Xu\{_^[@%u+Ehh@EP tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u80V@;8@t#58@|p0V@8@(@+_^[hhuP+ }?huPh.S@hd$@h}@(h8S@_^[hh@SZ2 thBS@\_^[ tMhNS@h}@(hu+PhxS@h}@t( 4S:s_^[@%u+Ehh@EPr t(V5@@V5@@0V@;8@t58@n@EP?m8@=8@u50V@8@(@hS@/SZr_^[á@EEu58@S0 ;Et hS@Sr_^[á@(@ t5(@V58@g Sq_^[ÉUSVuV4bVS@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u>L@;h@u+^[5h@&L@h@L@l@+^[VP~c3VS@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ thS@PhPPXh@ tBhh@P%L@;l@t5l@h@l@+^[ál@h@hh@PPhS@hd$@h}@w$hS@ ^[ÉUSVWu/t.u_^[hS@- uS@Sh@ahS@h@} t,E  t"u h@fhS@h@TVh@F@_^[ÃVW|$T$t$;t,f | BF +D$ tD$_^+_^fUPSVWheu= @|G @;_@}: @]@L@;h@uw +w ww7 5 @h]@V- u#^ t(Suhm hh]@hm V]PVhm hh]@h~m _^[ÉVWT$ t$ u_^ËfB8tBF  t_^fUSVW]sG u+@Pg tGC  u_^[+_^[UuafU SVWu] EEF% u @ +_^[à ~#V)uE;Euz+_^[ÃF;^}FWh 6u]E tE+E})~>F +E~}+FM;~ V)f}u + jEE_^[VW|$T$ t$D$|$|BF ;u_^+_^ÐkÐU$SVW}u @+_^[hu# }+_^[hEPW) Vr@u;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tWqj @+_^[E%u+EuEPfEuEPofEuEP[fEhd uWi @ +_^[CfEfC fCEPC Pg\h h/uVE tE@EPCP +}3D3FƁ|fEfEf t*uSW }SgW*i+_^[fEfEf t*uSW }S/Wh+_^[Wh @_^[ÉUSVE tSd uEp tf6Vd uud^[ÉU4SVWEhEPu' t @_^[uEPfEuuEuuEE u2EM+@EEuEM+@m؉E؋E؃Ppb u @ _^[fEfCECECECEC EC EC EE M8GE;}EEEE MЈL8GE;}E E̋E @;E}EE @MfA}hhuf Ehuuf u؍CPuz% ;EtSb @_^[huuyf Eؙ=r@PuCP E 8uE E 06>u+_^[U,SVW+hEPu$ t @_^[uEPSfEuuEuuEuuEuuEE uE+EGE tGP5` u @ _^[fEfCECEC EC ~ohhu"e Ehuu e WCPu# ;tSKa @ _^[huud E xuE XE p6>u+_^[ÃD$ tD$ D$D$ D$D$D$ à VT$t$D$ t&ƒ tFD$D$ƃfL$f^ ÉVWD$ tt4uwtLsD$D$D$D$ D$D$ D$D$ t$|$HfD$fD$fD$fD$ t$|$)D$D$D$D$ D$D$ D$D$ t$|$D$_^fUSV]uE tt-uxtJ^[ËÍ+5r@Pu V ^[Ëà tGfFfEffEƃM܋à t#FEFEFEEƃM^[UW+E+҃}DuBƒ|E |$r@+_Ë3_ÉVW|$T$t$T$f |$BF  u |ۋBD$_^ÐWT$ L$+:uA8u_ÉUSVW} 5 @hu؃t{u5 @E_^[Ã;C @;k C@;EEk KI|Ek KI<t5 @Ek KI_^[ËEk KIEMUEk C@D@P[MUEEk KIDPuSS5 @E_^[S5 @E_^[uWSK ES_}tE8t5 @E_^[É5 @E_^[ÉUSuL[ uhDs@h}@+[uhS [ÉUSVW}5 @ t u5 @_^[W t 5 @_^[hl u5 @_^[WmP@PCC uS'\5 @_^[Ws{RCCSt 5 @_^[s[S[5 @_^[ÐUSV5 @u  t 5 @^[h u5 @^[uO@PdC uSH[5 @^[usQCC5 @^[UDSVWEEMqF MA u _^[ËEEhhMA u _^[ËEp @@PuEp Z_^[ËE@ tEp \Z_^[ËE@ @ uEp 6Z_^[ËE@ @ uEp Z_^[ËE@ @EEMI I <W5XE uEp Y_^[WuE@@P  ;t#Ep Yu~Y_^[hhE@@P\ EȋI IHEEh MIAQIMA u#Ep Yu Y_^[hE@ @MI IP u1Ep XuXEpX_^[hE@ @MI IP u:Ep mXubXEpTXSKX_^[ËEE+MEfEEhEPuZ + EEȡ@s@ tEȊ@EҋEȊEӋEfMf@s@ tEȊ@EҋEȊ@EӋEfMfH@s@ tt?tU}EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HNEf@fE̋Ef@fE΋EȋM̉H-EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HE t+@s@ tEEҊEEӍEfMfE+ ~@s@ tutt-uftBbEE̊EE͊EEΊEEύEfMf>fEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMffEEhEPuX + EEȡ@s@ tEȊ@EҋEȊEӋEfMf@s@ tEȊ@EҋEȊ@EӋEfMfH@s@ tt?tU}EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HNEf@fE̋Ef@fE΋EȋM̉H-EȊ@E̋EȊ@E͋EȊ@E΋EȊ@EϋEȋM̉HE t+@s@ tEEҊEEӍEfMfE+ ~@s@ tutt-uftBbEE̊EE͊EEΊEEύEfMf>fEfEfEfE΍EfMf"EE̊EE͊EEΊEEύEfMf]؉uEfEEhEPuV  ẺE@s@ tE@EʋEEˋEfMf@s@ tE@EʋE@EˋEfMfH@s@ tt?tU}E@EċE@EŋE@EƋE@ENjEMĉHNEf@fEċEf@fEƋEMĉH-E@EċE@EŋE@EƋE@ENjEMĉHE+ t+@s@ tE͈EʊËEˍEfMfE+ ~@s@ tutt-uftBbE͈EĊËEŊEψEƊEΈEǍEfMf>fEfEfEfEƍEfMf"EψEĊEΈEŊE͈EƊËEǍEfMfE;EvẺEE̋M؍U̍򗥥EE;EE@؋E@fEfEfEf@fEEk MAMԇ񗥥GNjE@ @;uQEuE_^[fU$SVWh/u  thhs@u _^[hjs@ E u rs@Eh GE uhs@u _^[uQE@PO u+_^[uiGEu zhhP %Ffft(ftLft(fftTftlCuSFusDuSFuUDu[WS{FW.D^uWSWFW D:uWS3FWCC%CCFƀ>hs@PE dOE_^[NOhs@u_^[ÉUSVW} u+_^[WCC@PqMWVqEh:V u C:uCPW=E_^[ÉUSVuB@P MuSEh_S) u+^[^[ÐUSVh_u u+^[CSrB@PLSVDh.V u+^[^[ÉUSVh.u u+^[CS B@P8LSV8D^[fUS+E @IEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u @[Cà }<@ +[fUS+f <@E@ @IEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tC } E@[US]t{u[s t5hhC@PN uS[+[+[ÐUSVW}]+L;<@u> }- +ÃP@PC@PM ć@Cà } <@u+Jfk Gxt8+&k G@<tk G@4JFk G@;CËG @;+$k Gxtk GpvJCËG @;+%fk Gxtk GpBJCËG @;ӃwcCt wJ t w J t WI_^[US] fEhSu> t[hEPCP0L E%u+@s@@s@ tCEEfEf@s@ tCECEfEfC@s@ tCECEfEfC@s@ tCECEfEfC@s@ tCECEfEfC+[fUSVWE m;]s}t } t+_^[SG u+_^[ËC+5s@EE}| ǃ_^[ÉUueHfT$L$:uËA8u+ÉUSs@fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[ÃÃ84+[fUSVu t u+^[V u V ^[S=^[ÉUSVWu}F u(F% tfN @ _^[VWu F t _^[Ë_^[ÉUdPu u(ÉUS]S?Su u [ÉUSVW]E u+_^[ËE @+E fft*ftKfuV t  ? t  u!E t++_^[hWu: E }+_^[CfEfC tE rufC+CC }t!hhuH u+_^[Ë_^[USVWE +84@ƀ@;sC% u_^[à ;rG;}} <@u;}}8EP:C@ tuh4@ _^[+_^[ÐUVW}E ME_^]ÐHÐUSV] u^[Ã} uSȋ^[Éh@@PSEPT |DE ;Eu^[ u+# h@D|@ +|@ t;u+^[ÐUSVW}t} u _^[ËE  uE+_^[áh@0:^:^F tcuLE @:FE @:F }} _^[M I M_^[ËM_^[ÃuTE @N+N+|tP}} _^[M I M_^[N+|tËM_^[Ë6 _^[SVt$ u+^[+~ u+8 u+- h@D|@ h@I;|@ ^[ u+# h@D|@ +|@CÀ>{^[ÉUSVW]} C @;}k C@;EEk KI4~Ek KI<Ek KIEMVBR?MUE u u@_^[hvsV shF@Put u@_^[ËE_^[ËEk KI_^[Íu@_^[fUSVW]fcC }}i{tcC uXs} }uhhCP D +)u C% u ~;C+; ;){+_^[C% t Cfcuu CPC CuC% tYS9C% tCfcC tuu CPiC &uu CPTC  @ u _^[+_^[USVW]} ~}+_^[ËE m{-SuE +u M+ȋ_^[ÃC;ssCW3u5 ljE){;C +E{}+CM;~ S<+ xE_^[USVW]E {u S;C u(C% tfK @ _^[CD t]E?fE<@ǀ4@;sF@ t V8 ;rEE;E} E<@uCC tC +CPsCPT CC{| _^[Ã{tfK fKC% tfcC_^[fAÐUEPuU SVW]]+EFƋE8t E=u=@FfVS7 u.E=u+@=$v@M EE_^[Ãǃ?u+_^[ÐVT$t$ fF :uB=u^ uF=u^+^ÉSVW|$\$t$;u+_^[f |F :uC u+_^[ }+_^[ +_^[fU$SVEEE܉EfEuEPVu  ؋E^[ÐUSVWEDž Džx@؋x@EƅEu _^[ÍL@;h@u?8%u@%t8tr%u@%tSu+, h@D|@ + |@ u_^[Ë%unf|@ u|@@ 8@A t̋$u#u uO"u _^[fE8"EE%L@;h@uE8t^E%tSE}tHE8t@E%t5}u+&E h@D|@ +|@EE벋E+u=E@x}uP3EkE@% t;EM+QM1H/ M+ uE+PhO-E@ t _^[ÍL@;h@uE+ERE+u+D u+3 h@D|@ h@I;|@;E++E+; u+P u+9 h@D|@ h@I;|@ } _^[ËE+;aEEE8EDž EE|@ u|@@ 8@A t̋$u$u& @E+EEEȉẺEЉEԉEfEff=B|ft0futFEEFC E}~ u卝P|v@ܝ4tj0 } ؉ t?fH =xv@0H učC;HsHH0H0|v@ܝ4 t+-HH=|@ǃ u|@@ 8@A  tEeH}" P+ȉH"ȋE+E }}E uE E H4H8 4H8,P0P}<}E<P84؃,t,E;0||v@ܝ4u"y@L&}t$y@L}t &y@LP|@ u3|@@ 8@A tC tFP 0 Dž$fF ~  u $ t0$$C }u}~7L@;h@uF.!h!#PV">tF}<}E< E+ E܃ |[F00~  u $ t0$$C땍P}s+ËM++M܉M_}} E }uE uE E H4H8 4H8,P0P}}EP84|@ u|@@ 8@A B|v@ܝ4u Dž0E쉅$}uJS ;$} $$|$0u $ۃ0| 0;E~$E$+0ELjPqEă}tg uE E @ PP1. } _^[ÍP؋  uE E @ ȇ@ȇ@% u%ȇ@=ȇ@ȇ@% u%ȇ@=ȇ@ȇ@% u%ȇ@=ȇ@ȇ@%Sȇ@%Rȇ@%Qȇ@%P PP u+@P u+1P h@D|@ h@I;|@ } _^[Ãu DžP؋}t+EȿsEă} uE E @ }}E쉅}}.h@@M ȉ E쉅8~~u|@ tL@;h@ t|@P5|@PPJ+$)E$)s} )E}} e}uRZE;E f8|@ tL@;h@ t|@P5|@PP3* } _^[ÍP u+@P u+1P h@D|@ h@I;|@)E}A+0 uE E X  }}E쉅}}VtE8;u+D u+3 h@D|@ h@I;|@Eu+, h@D|@ + |@ A}}S} u+8 u+- h@D|@ h@I;|@)E}>t7 u+# h@D|@ +|@ yEO>tIE}|? u+# h@D|@ +|@ u _^[Ã}}E}}E}ts t+=tv@+É E E܉L u+L@ uȍE+Hȉ$}fEE;$E@x}u ȇ@PE ȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[EFL E@x}%uLLȇ@P" ELLȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[E4E}E@x}u0ȇ@PcE0ȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[EK }(sP 80S>$ } _^[à u+8 u+- h@D|@ h@I;|@u4E@x}uP)EE@% E u+8 u+- h@D|@ h@I;|@PSE08 u+8 u+- h@D|@ h@I;|@ȋRu u+8 u+- h@D|@ h@I;|@PhSE@ t _^[ÍL@;h@uH u+8 u+- h@D|@ h@I;|@E u+8 u+- h@D|@ h@I;|@ u+8 u+- h@D|@ h@I;|@;5 u+8 u+- h@D|@ h@I;|@+ u+H u+5 h@D|@ h@I;|@ } _^[Ë u+8 u+- h@D|@ h@I;|@;6EE u.E@x}uP~dETE@% t-E SM1  u hSE@ t _^[ÍL@;h@u E u+8 u+- h@D|@ h@I;|@;  +;  u+H u+5 h@D|@ h@I;|@ } _^[Ë; pEEE}E@x}u0ȇ@PE0ȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[EKfH E@x}%uHHȇ@P EHHȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[E4EE;$}E@x}u ȇ@PE ȇ@tRȇ@ u+@ȇ@ u+1ȇ@ h@D|@ h@I;|@ } _^[EFE_^[ÉU(SVW]+uEE=x@x@x@P=̇@5x@*Ї@=̇@t =Ї@ ux@+_^[ËEE;x@}EЇ@EE܋E;x@|;2%t8 u+# h@D|@ +|@ u+_^[EC+k MЍ<CE|@ u|@@ 8@A  uC;}~}E;x@x@x@P5̇@̇@5x@5Ї@Ї@=̇@t =Ї@ ux@+_^[ËEE;x@}EЇ@EE܋E;x@|fft ftfuC|@ u|@@ 8@A tC* CÉ]f|@ u|@@ 8@A tC$uE;E~EEE;x@x@x@P5̇@ṙ@5x@5Ї@YЇ@=̇@t =Ї@ ux@+_^[ËEE;x@}EЇ@EE܋E;x@|EЇ@dFC.DC|@ u|@@ 8@A u׉]* CÉ]C|@ u|@@ 8@A u$u;E;E~EEE;x@x@x@P5̇@$̇@5x@5Ї@ Ї@=̇@t =Ї@ ux@+_^[ËEE;x@}EЇ@EE܋E;x@|EЇ@dFCEfftftftfuECECÉ}Cff=%|7f=C|!ff f=5$w@ff EЇ@E؃}tldM؈FNEЇ@nF:EЇ@fF&EEЇ@E؃}twdM؈FEEЇ@E؃}tWsM؈FEE;EEЇ@ff=W|3f=d|!ff f=$w@ftvfE܋ ̇@E U E܋ ̇@E U E܋ ̇@E U RgE܋ ̇@E U OE܋ ̇@E U R7E܋ ̇@E U RE܋ ̇@E U +_^[E܋E;Ė@_^[ÃSVW\$ +D$ fftftft futGCCf0|79/k C Ћ;D$ } @"+_^[Ét$ t _^[Ë_^[ÐUhuuuu u$ÉUhuuuu uÉUE}fEfEf fEm]m̋EĉE0Em y@];rF5|0ԇ@;uԇ@1}tG09ԇ@_^[É(SVWD$8D$D$;F à t^[Vu ^[^[Fu:F]hEPFP u^[fN ^[Fu~ u);Fu~ t FD   t V<+ t ^[FD VCF~}VP F t ^[^[fUSVW]{+ljE;CD t+C +CCC +E{}+CM;~,]Ëˋ@ + } EȋI E;p}EpE}~DfuEPCP E~E)EEE}fK _^[+_^[USVW]Ct/C% u @ _^[CfC{u S];CuLCD uAC +CCC +E{}+CM;~G + }G ;w}w+_^[USV]sC t hCfKCC ]}@CC DhC tfKCC hCfKCC CVQ tC ufK@^[ÉD$L$@ + }D$L$I ËD$;P}D$PÉUS @EPhTu }  @+[ø[USVW=@uxU@h؍GO#+‹ }@ tWlu+_^[+E@;EveFơ@;Ew5@@;ErE+@E5@E;Es fe}u+_^[FƋE;Er8@ uV.8@ u+_^[Ë8@ƈCC_^[USVWEȸ ~V;5@}=@ǙE=@EWQ؃tE8@E}~ _^[f|$uËD$tAЋ8@ 8@USVWE}uu _^[ËEu EG.hW }54}@W }Fȸ;@s @؃}tF t%Fȸ;5@} @;] r ;u sE_^[uu EE u+_^[ËE;Et;] vE Puu4 E_^[ÐW+Ƀ}-+8@;T$u_GNj t;|$ uA|Ӹ_USVWu~}FF t F؋HF% t'+F t.~t(F u+F @ _^[+ ~(hhFP u _^[Ëǃ thhFPO hhFP4 |_^[ÉUVWu} Mq;w$g;r-NOIft3ft,ftftIt(ftft rft_^]Ð>ÐL$ @@r[L$r @ @ã @ËL$@r&r @ã @ @ÐVÐBø*ÐÐ6Ð @ÐVWT$t$ t u+_^ál@x f;w;w vG tLG t*G%BO_^ËG%_^Ë+GD$G t @./terminfo.srcbas2.catTerminfo entry too long: bas2.catInfinite use= loop '%s' ext.catCannot find term %s lib.catcreate '%s' bas2.catbool cap %s code %s val %d bas2.catnum cap %s code %s val %d bas2.catstr %s code %s val %s bas2.catstr %s code %s val NULL system.catlink '%s' '%s' bas2.cat%s: terminal name too short system.catunlink %s bwamxsbxhpxenleognhckmhsindadbmirmsgroseslokxthzulxonbwamxbxsxneognhckmhsindadbmimsosesxthzulxocolsitlineslmxmcpbvtwslcoitlilmsgpbvtwscbtbelcrcsrtbccleareledhpacmdchcupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdch1dl1dslhdsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmsosmulechrmacssgr0rmcuprmdcrmirrmsormulflashfffslis1is2is3ifich1il1ipkbsktbckclrkctabkdch1kdl1kcud1krmirkelkedkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9khomekich1kil1kcub1kllknpkppkcuf1kindkrikhtskcuu1rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmnelpaddchdlcudichindnilcubcufrincuupfkeypflocpfxmc0mc4mc5reprs1rs2rs3rfrcvpascindrisgrhtswindhttsluchuiprogka1ka3kb2kc1kc3mc5pbox1box2batt1batt2colb0colb1colb2colb3colb4colb5colb6colb7colf0colf1colf2colf3colf4colf5colf6colf7font0font1font2font3font4font5font6font7kbtabkdokcmdkcpnkendkhlpknlknpnkpcmdkppnkquitkselksclkscrktabkmpf1kmpt1kmpf2kmpt2kmpf3kmpt3kmpf4kmpt4kmpf5kmpt5apstrkmpf6kmpt6kmpf7kmpt7kmpf8kmpt8kmpf9kmpt9ksf1ksf2ksf3ksf4ksf5ksf6ksf7ksf8ksf9ksf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63dispcsmpchrmpchsmscrmscscescscesapctrmkentkprtkrstkICkoptkHOMkprvkDCkENDknxtkLFTkRITkbegkreskrfrkextkspdbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pObxbyBxByd0d1d2d3d4d5d6d7c0c1c2c3c4c5c6c7f0f1f2f3f4f5f6f7kOkikckWkwkqknkvkpkVkQkUkzkZkoKvKVKwKWKxKXKyKYKzKZzaKrKRKsKSKtKTKuKUS1S2S3S4S5S6S7S8S9SAk<k>SaSbScSdSeSfSgShSiSjSkSlSmSnSoSpSqSrSsStSuSvSwSxSySzS!S#S$S%S&S(S)S*S+S,S-S.S/S:S;S<S=S>S?S@S[S]S^S_S{S|S}S~XaXbXcXdXeXfXgXhXiXjXkXlXmXnXoXpXqXrXsXtXuXv @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @L @P @T @X @\ @b @f @j @n @r @v @z @~ @ @ @ @ @ @ @ @ @ @" @& @* @. @2 @6 @: @ @ @ @ @ @ @ @ @n@r@v@z@~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@"@&@*@.@2@6@:@>@B@F@J@N@R@V@Z@^@b@f@j@n@r@v@z@~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@"@&@*@.@2@6@:@>@B@F@J@N@R@V@Z@^@b@f@j@n@r@v@z@~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@"@&@*@.@2@6@:@>@B@F@J@N@R@V@Z@^@b@f@j@n@r@v@z@~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@"@&@*@.@2@6@:@>@B@F@J@N@R@V@Z@^@b@f@j@n@r@v@z@~@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@> @B @F @J @N @R @X @\ @` @d @j @n @t @z @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @& @, @2 @6 @: @> @B @F @J @P @T @X @\ @b @h @n @t @z @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @" @& @* @. @2 @6 @: @> @B @F @J @N @R @V @\ @` @d @h @l @p @v @| @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @" @( @. @4 @: @@ @F @L @R @X @^ @d @j @p @v @| @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @@@@@@ @&@,@2@8@>@D@J@P@V@\@b@h@n@t@z@@@@@@@@@@@@@@@@@@@@@@@@ @@@@"@(@.@4@:@@@F@L@R@X@^@d@j@p@v@|@@@@@@@@@@@@@@@@@@@@@@@@ @@@@"@(@.@4@8@>@D@J@P@V@\@b@h@@(#)NLstrlen.c 1.9 AIX@(#)NLfprintf.c 1.9 AIX@(#)NLprintf.c 1.9 AIX@(#)NLsprintf.c 1.7 AIX@(#)system.c 1.13 AIX-csh/bin/sh@(#)runl.c 1.7 AIX@(#)runv.c 1.7 AIX@(#)dup2.c 1.8 AIX@(#)NLstrcat.c 1.8 AIX@(#)NLstrcpy.c 1.9 AIX@(#)NLstrncmp.c 1.10 AIX@(#)NLxcol.c 1.9 AIX@(#)NLstrncpy.c 1.9 AIX@(#)signal.c 1.12 AIX@(#)sigaddset.c 1.3 AIX@(#)cuexit.c 1.8 AIX@(#)sigmptyset.c 1.1 AIX@(#) stat.c 1.2 LCC@(#)mbtowc.c 1.4 AIX@(#)mbscat.c 1.1 AIX@(#)mbscpy.c 1.1 AIX@(#)wcscat.c 1.1 AIX@(#)wcscpy.c 1.1 AIX@(#)wcsncpy.c 1.1 AIX@(#)wcindx.c 1.6 AIX@(#)wcxcol.c 1.3 AIX@(#)mbstowcs.c 1.3 AIX@(#)mbsadvance.c 1.1 AIX@(#)mblen.c 1.3 AIX@(#)catgets.c 1.1 AIX@(#)'src.com/lib/libc/Lposix/setlocale.c, bos, 130, 0012' 1.3 AIX%m/%d/%y%h %d %Y%a %h %d %H:%M:%S %Z %YCSunday:Monday:Tuesday:Wednesday:Thursday:Friday:SaturdaySun:Mon:Tue:Wed:Thu:Fri:SatJanuary:February:March:April:May:June:July:August:September:October:November:DecemberJan:Feb:Mar:Apr:May:Jun:Jul:Aug:Sep:Oct:Nov:Dec%H:%M:%SAMPM-.:,at:each:every:on:through:am:pm:zulu.:,:3:$:$:.:,:3:+:-:2:2:1:0:1:0::1:1now:yesterday:tomorrow:noon:midnight:next:weekdays:weekend:todayno:n:Nyes:y:YCCCC.eb.cctC.eb.cctsetlocale: Unable to open %s file "%s" 8\@>\@J\@T\@`\@l\@t\@\@ \@ \@ \@ \@ \@\@\@\@\@\@\@\@\@\@]@ ]@]@]@$]@.]@8]@@]@H]@ P]@ p"@ |"@ "@ "@ "@"@"@T#@#@#@#@#@#@#@#@#@0$@8$@@$@D$@H$@L$@ X$@ p"@ |"@ "@ "@ "@"@"@T#@#@#@#@#@#@#@#@#@0$@8$@@$@D$@H$@L$@ X$@     (@)@$)@@)@8)@L)@)@C C C C C CXXCCCCCCC%s %s %s %s %s %sCCCC.en.enrconfigurationsetlocaleLANGCLANGCOut of memory Out of memory Ccollationsetlocaleread errorsetlocale: bad magic number for ctab file "%s" lseekmallocread errorread errorread errorsetlocale read errorsetlocale lseekmallocsetlocale lseeksetlocale read errorCcollationsetlocaleread error:setlocale: bad magic number for ctab file "%s" mallocread errorC.cct.cctconversionsetlocaleMBCS_CFG_DIR/usr/lib/mbcs//  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~LANGLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGELOCFILEMBDATEMBLANGMBLDATEMBLDATIMMBLDAYMBSDAYMBLMONTHMBSMONTHMBTIMEMBAM_STRMBPM_STRLANGMBCURSYMMBNUMSEPMBTMISCMBMONEYMBTSTRSMBNOSTRMBYESSTRMBCOLTABMBCTYPEMBCONVTMBNLINMBNLOUT@(#)memcmp.c 1.7 AIX@(#)perror.c 1.15 AIXError %d occurred.: j@_@_@ b@c@c@ e@4f@lg@h@li@`@`@a@a@a@a@a@a@b@b@, cub1=^H, am, cup=\E[%i%p1%d;%p2%dH$<5>, cuf1=\E[C$<2>, cuu1=\E[A$<2>, el=\E[K$<3>, ed=\E[J$<50>, cud=\E[%p1%dB, cuu=\E[%p1%dA, cub=\E[%p1%dD, cuf=\E[%p1%dC, smso=\E[7m$<2>, rmso=\E[m$<2>, smul=\E[4m$<2>, rmul=\E[m$<2>, bold=\E[1m$<2>, rev=\E[7m$<2>, blink=\E[5m$<2>, sgr0=\E[m$<2>, il1=\E[L, dl1=\E[M, sgr=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m, rs2=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h, smkx=\E=, rmkx=\E>, tbc=\E[3g, hts=\EH, home=\E[H, kcuu1=\E[A, kcud1=\E[B, kcuf1=\E[C, kcub1=\E[D, kbs=^H, kf1=\EOP, kf2=\EOQ, kf3=\EOR, kf4=\EOS, ht=^I, ri=\EM$<5>, vt#3, xenl, xon, sc=\E7, rc=\E8, csr=\E[%i%p1%d;%p2%dr, smcup=\E[?7l\E[?1l\E(B\E=, rmcup=\E[?7h, box1=\154\161\153\170\152\155\167\165\166\164\156, batt1=f1, box2=\154\161\153\170\152\155\167\165\166\164\156, batt2=f1md, font0=\E(B, font1=\E(0, msgr, kf5=\EOu, kf6=\EOv, kf7=\EOw, kf8=\EOx, kf9=\EOy, kf10=\EOp, kf11=\EOq, kf12=\EOr, kdch1=\E[3~, khome=\E[H, kich1=\E[2~, knl=^M, ktab=^I, # normal vt100 entry, no auto margin. # vt100x is needed for usability use of vt100 emulation vt100|vt100-nam|vt100x|vt100 w/no am, am@, xenl@, use=vt100-am, # # Usability entry for DEC vt100 # D1.U|vt100.U|Digital Equipment Co VT100, kcmd=\EOq, khome=\EOt, kdo=\EOP, knp=\EOl, kpcmd=\EOr, kpp=\EOv, khlp=\EOS, kdch1=\EOn, kquit=\EOQ, ksel=\EOy, knpn=\EOs, kend=\EOu, kcpn=\EOm, kmpf1=\EOx, kmpt1=301, kmpf2=\EOw, kmpt2=303, kmpf3=^Ad, kmpt3=289, kmpf4=^Aq, kmpt4=290, kmpf5=^As, kmpt5=298, ksf1=^A1, ksf2=^A2, ksf3=^A3, ksf4=^A4, ksf5=^A5, ksf6=^A6, ksf7=^A7, ksf8=^A8, ksf9=^A9, ksf10=^A0, kf1=^C1, kf2=^C2, kf3=^C3, kf4=^C4, kf5=^C5, kf6=^C6, kf7=^C7, kf8=^C8, kf9=^C9, kf10=^C0, apstr=\0000000003e3e2b20302e, use=vt100-nam, # #usability entry for vt100 emulation # vt100x.U|Digital Equipment co VT100, khlp=\EOm, kpcmd=\EOr, kcmd=\EOq, ksel=\EOv, kcpn=\EOM, knpn=\EOs, kdo=\EOw, kquit=\EOx, kmpf1=\EOu, kmpt1=301, khome=\EOP, kend=\EOR, knp=\EOQ, kpp=\EOS, kmpf2=\EOt, kmpt2=303, use=vt100.U, # Ordinary vt100 in 132 column ("wide") mode. vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video), cols#132, lines#24, rs2=\E>\E[?3h\E[?4l\E[?5l\E[?8h, use=vt100-am, #vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video), # cols#132, lines#24, rs2=\E>\E[?3h\E[?4l\E[?5l\E[?8h, vt@, #use=vt100-nam, # vt100's with no advanced video. #vt100-nav|vt100 without advanced video option, # sgr@, smso=\E[7m , rmso=\E[m , xmc#1, # smul@, rmul@, bold@, rev@, blink@, sgr0@, use=vt100, #vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video), # lines#14, cols#132, use=vt100-nav, # vt100's with one of the 24 lines used as a status line. # We put the status line on the top. #vt100-s|vt100-s-top|vt100-top-s|vt100 for use with sysline, # lines#23, is2=\E7\E[2;24r\E8, clear=\E[2;1H\E[J$<50>, home=\E[2;1H, # dsl=\E7\E[1;24r\E8, # cup=\E[%i%p1%{1}%+%d;%p2%dH$<5>, csr=\E[%i%i%p1%d;%p2%dr, # hs, eslok, tsl=\E7\E[1;%p1%dH\E[1K, fsl=\E8, use=vt100-am, # Status line at bottom. Clearing the screen will clobber status line. #vt100-s-bot|vt100-bot-s|vt100 for use with sysline, # lines#23, is2=\E[1;23r\E[23;1H, dsl=\E7\E[1;24r\E8, # hs, eslok, tsl=\E7\E[24;%p1%dH\E[1K, fsl=\E8, use=vt100-am, # vt132 - like vt100 but slower and has ins/del line and such. #vt132|vt132, # il1=\E[L$<99>, dl1=\E[M$<99>, ip=$<7>, dch1=\E[P$<7>, rmir=\E[4l, # smir=\E[4h, xenl, ind=^J$<30>, use=vt100, # # entry for DEC VT220 terminal with 8 bit controls. # #vt220|Digital Equipment Co VT220, # bel=^G, ed=\233J, el=\233K, # cr=^M, ind=^J, # il1=\233L, dl1=\233M, # box1=\154\161\153\170\152\155\167\165\166\164\156, batt1=f1, # box2=\154\161\153\170\152\155\167\165\166\164\156, batt2=f1md, # clear=\233H\233J, cup=\233%i%p1%d;%p2%dH, # cols#80, cud=\233%p1%dB, cud1=\233B, eo, # lines#24, # it#8, font0=\E(B, font1=\E(0, kf1=\217P, # kf2=\217Q, kf3=\217R, kf4=\217S, kf6=\23317~, # kf7=\23318~, kf8=\23319~, kf9=\23320~, kf10=\23321~, # kbs=^H, kdch1=\2333~, kcud1=\233B, # kdo=\23329~, kich1=\2332~, kcub1=\233D, km, # knl=^M, knp=\2336~, ktab=^I, # kpp=\2335~, khlp=\23328~, kcuf1=\233C, kcuu1=\233A, # cub=\233%p1%dD, cub1=^H, li#24, blink=\2335m, # smcup=\233?7l\233?1l\E(B, rmcup=\233?7h, # bold=\2331m, sgr0=\2330m, rev=\2337m, # cuf=\233%p1%dC, rmso=\2330m, smso=\2337m, cuf1=\233C, # sgr=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m, # rmul=\2330m, cuu=\233%p1%dA, cuu1=\233A, smul=\2334m, # # Usability entry for DEC vt220 # #vt220.U|Digital Equipment Co VT220, # kcmd=\23318~, kpcmd=\23319~, kquit=\23331~, ksel=\23325~, # knpn=\23321~, kend=\217Q, kcpn=\23326~, kmpf1=\23324~, # kmpt1=301, kmpf2=\23323~, kmpt2=303, kmpf3=\217R, # kmpt3=275, kmpf4=\217S, kmpt4=274, khome=\217P, # kmpf5=^Ad, kmpt5=289, kmpf6=^Aq, kmpt6=290, # kmpf7=^As, kmpt7=298, # ksf1=^A1, ksf2=^A2, ksf3=^A3, ksf4=^A4, # ksf5=^A5, ksf6=^A6, ksf7=^A7, ksf8=^A8, # ksf9=^A9, ksf10=^A0, # kf1=^C1, kf2=^C2, kf3=^C3, kf4=^C4, # kf5=^C5, kf6=^C6, kf7=^C7, kf8=^C8, # kf9=^C9, kf10=^C0, # apstr=\0000000003e3e2b20302e, # use=vt220, # # entry for DEC VT220 terminal # This entry is defined for vt220 when using 7 bit controls. # vt220|Digital Equipment Co VT220, bel=^G, ed=\E[J, el=\E[K, cr=^M, ind=^J, msgr, il1=\E[L, dl1=\E[M, box1=\154\161\153\170\152\155\167\165\166\164\156, batt1=f1, box2=\154\161\153\170\152\155\167\165\166\164\156, batt2=f1md, clear=\E[H\E[J, cup=\E[%i%p1%d;%p2%dH, cols#80, cud=\E[%p1%dB, cud1=\E[B, eo, lines#24, it#8, font0=\E(B, font1=\E(0, kf1=\EOP, kf2=\EOQ, kf3=\EOR, kf4=\EOS, kf6=\E[17~, kf7=\E[18~, kf8=\E[19~, kf9=\E[20~, kf10=\E[21~, kf11=\E[23~, kf12=\E[24~, kbs=^H, kdch1=\E[3~, kcud1=\E[B, kdo=\E[29~, kich1=\E[2~, kcub1=\E[D, km, knl=^M, knp=\E[6~, ktab=^I, kpp=\E[5~, khlp=\E[28~, kcuf1=\E[C, kcuu1=\E[A, cub=\E[%p1%dD, cub1=^H, li#24, blink=\E[5m, smcup=\E[?7l\E[?1l\E(B, rmcup=\E[?7h, bold=\E[1m, sgr0=\E[0m, rev=\E[7m, cuf=\E[%p1%dC, rmso=\E[0m, smso=\E[7m, cuf1=\E[C, sgr=\E[%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;m, rmul=\E[0m, cuu=\E[%p1%dA, cuu1=\E[A, smul=\E[4m, # # For PCI EM2 Scan Code vt220pc, lines#25, use=vt220, dispc=%?%p2%{32}%<%t%p2\E%c%e%p2%{128}%<%t%p2%c%e%p2%{160}%<%t%p2\E%c%e%p2%c%;, smsc=\E[?99h\E[?98h\E*P\En, rmsc=\E[?99l\E[?98l\E*<, u0=eg, u1=\E[?97h, u2=\E[?97l, # # Usability entry for DEC vt220 with 7 bit controls. # vt220.U|Digital Equipment Co VT220, kcmd=\E[18~, kpcmd=\E[19~, kquit=\E[31~, ksel=\E[25~, knpn=\E[21~, kend=\EOQ, kcpn=\E[26~, kmpf1=\E[24~, kmpt1=301, kmpf2=\E[23~, kmpt2=303, kmpf3=\EOR, kmpt3=275, kmpf4=\EOS, kmpt4=274, khome=\EOP, kmpf5=^Ad, kmpt5=289, kmpf6=^Aq, kmpt6=290, kmpf7=^As, kmpt7=298, kf1=^C1, kf2=^C2, kf3=^C3, kf4=^C4, kf5=^C5, kf6=^C6, kf7=^C7, kf8=^C8, kf9=^C9, kf10=^C0, ksf1=^A1, ksf2=^A2, ksf3=^A3, ksf4=^A4, ksf5=^A5, ksf6=^A6, ksf7=^A7, ksf8=^A8, ksf9=^A9, ksf10=^A0, kf1=^A1, kf2=^A2, kf3=^A3, kf4=^A4, kf5=^A5, kf6=^A6, kf7=^A7, kf8=^A8, kf9=^A9, kf10=^A0, apstr=\0000000003e3e2b20302e, use=vt220, # # Special vt220 which has 25 lines for use with DOS # vt220-em, lines#25, use=vt220, dispc=%p2%c, smsc=\E3, rmsc=\E4, # # Special vt100 which has 25 lines for use with DOS # vt100-em, lines#25, use=vt100, dispc=%p2%c, smsc=\E3, rmsc=\E4, # # EXECUTION ENVIRONMENT: # # xterm entry for DEC vt100 emulation. xterm|vs100|xterm terminal emulator, ind=^J, cols#80, lines#25, clear=\E[H\E[2J, cub1=^H, am, cup=\E[%i%p1%d;%p2%dH, cuf1=\E[C, cuu1=\E[A, el=\E[K, ed=\E[J, cud=\E[%p1%dB, cuu=\E[%p1%dA, cub=\E[%p1%dD, cuf=\E[%p1%dC, km, smso=\E[7m, rmso=\E[m, smul@, rmul@, bold=\E[1m, rev=\E[7m, blink=@, sgr0=\E[m, rs1=\E>\E[1;3;4;5;6l\E[?7h\E[m\E[r\E[2J\E[H, rs2=@, kf1=\E[11\176, kf2=\E[12\176, kf3=\E[13\176, kf4=\E[14\176, ht=^I, ri=\EM, vt@, xon@, csr=\E[%i%p1%d;%p2%dr, il=\E[%p1%dL, dl=\E[%p1%dM, il1=\E[L, dl1=\E[M, ich=\E[%p1%d@, dch=\E[%p1%dP, ich1=\E[@, dch1=\E[P, use=vt100-am, xterms|vs100s|xterm terminal emulator (small screen 24x80), cols#80, lines#24, use=xterm, 7 k&n tI?++毄-t ./usr/nifl/rtmc/bin/386.rtmcu+ XLHH @.textHHH .dataH @H @XH@.bss\a@\a@L.fkd800D".fkdc00ܴB.lib\Hܨ#AHܨ#AHH @H H+ HܮHؐÐ׋ETH @RU RP-L @ P-L @jUSVW@<@@<@<@ @̲h@<@P ؃h@؃( uh@h*؃ha؃(h@hc@ ؃ hhc@؃ }#=Fth @؃h؃+@@@j@A+})@c@`e@e@Fƃ|h(,P_؃,Phc@h@hX@ ؃,Phc@h@hĺ@ ؃xP8 ؃xP5؃||p ,Phc@h"@h$@ ؃hhxEPh$@ ؃ |Lx+E=~FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u DždCÃFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@CÃh$h@h6h 5S@jhOh5S@R 5S@ @+E@;@v=h@E+@;@} = @E@@;@t @ D@ѹPh@h@5 @׃ @} h@׃@;@t6@ @ѹPD@ @ѹP=@tE+@;@| $E@ @ w Ph׃S׃_^[fUhh5S@ 5S@hEp@LÉUhh׃h@p@hOh5S@j 5S@fUShhI׃hh5S@) 5S@+5@׃=c@t5c@׃+*;<@tf@x0tf@p(`׃CÁ} h$h @h6h @;<@t* @pX׃e@ @pC׃c@hc@׃3ssh@h>hHhe@׃3ssh@hGh@;<@uh.@h6h h2@h6h = @t5h:h5S@P u+Hh6@5S@3h:h5S@ u+h:@5S@P5S@<@  @ $@P5S@j@k<T @t3hLh5S@ u+h>@5S@j@k<` @t3hKh5S@c u+h<5S@j@k<\ @t3hNh5S@ u+h>5S@j@k<X @t3hLh5S@ u+hB@5S@5S@8@ @ @P5S@thh5S@x u+hF@5S@5S@OhOh5S@7 5S@^[ÉUSVWE+h hh7h@@hhEPd׃ }`EhP8@ @ @P5S@hh5S@ u+hz@5S@5S@[5S@8@  @P5@@@@ @@+ffP5@@@@@@@@P@@@Phh5@@0 @ @ 8@P5@@hh5@@ u+h@5@@ٿ5D@5@@YahOh5S@X 5S@5S@P%׃=|#%I | 1$@ 5@@5@@@@7ES@ S@+ffP5S@CS@@5@ly+hhEP׃ =`@u @@=`@u @@=`@u @@E u!u `@`@EPr׃ ~5`T-=`@u5@=`@u5@=`@u5@u `@`@]+hhEP׃ uCψLEP׃Ph@h*`@P5@@h*`@P5@@ u+%@ @ 8@Ph 5@@w 5@@M DEPL׃Ph@h*`@P5@@#h*`@P5@@_ u+%@ @ 8@Ph 5@@ڸ 5@@E@;_^[ÐU5@h@hh5@@葻5@h@hh5@@n5@hJ@hh5@@K=`@| `@=`@} `@h*`@P5@@a u+%@ @ 8@Ph 5@@ܷ 5@@ÐUSVh蠋@ @ @P5S@hh5S@ u+h@5S@ 5S@$@ D@P5S@uhFP5S@z u+h2@5S@诺hFP5S@H u+h^@5S@}hFP5S@ u+h@5S@KhFP5S@ u+h@5S@hFP5S@ u+h@5S@hFP5S@ u+h@5S@赹hFP5S@N u+h @5S@胹hV5S@ u+h5S@h<@hFPZ hFP5S@ u+h`@5S@ hFP5S@ u+h@5S@ڸhFP5S@s u+h@5S@訸hFP5S@A u+h@5S@vhV5S@ u+h5S@hFP5S@ u+h@5S@hFP5S@ u+h@5S@hFP5S@| u+h@5S@豷hV5S@M u+h5S@h<@hFP舶 hFP5S@ u+hZ@5S@:FhV5S@ u+h5S@`hFP5S@ u+ht@5S@ֶhFP5S@o u+h@5S@褶hFP5S@= u+h@5S@r5S@8@ @ @P5S@ؾhh5S@ u+h@5S@5S@賾hOh5S@ 5S@5S@7Ph׃ÃQu ÃCu?^[ÉUXSVW+hӅhh5S@' u+hd@5S@\5S@hPhEPr׃ 5S@P׃ uu tu 뻃D CΈLhh5S@v u+EP5S@謴5S@n5S@OOEP׃+ۃ2}"WEP4x@׃ uCÃ2|ޡ8@ @ @P5S@ļ 2|EPhf@hh#%4|@4x@hx@hh5S@肼h@5S@迳5S@聲5S@ PhH׃h׃5S@_^[ÐU(SVWE+E+}.+ۃ}k @;Eu]CÃ|Fƃ|ҡ8@ @ @P5S@蕻hh5S@ u+hP!@5S@β5S@p5S@hhhKh E8@  @PuEM+ffPuE@E@PE@Phhu: @ @ 8@Pu譺hhu u+h!@u++ۃsu{k @4׃E t5}t/k Pk@PuB u+hu};]u#;u8@ @ @PuݹH@ @PuĹk PkPu } }0Eh uPE +E=8!@;Ek @4uɰ} }0Eh uE +E=8!@;Eu8 u}huCÃFƃvuhOh5S@ 5S@bEE5S@zP׃E}ub5S@ZE}[uK5S@CE}Au E+}Bu E}Cu E }DuEE=|(tQYm*[8u^Gǃ}Ek @<:+E܃}+E E}}EEk @<E}}E }E]k @CPh"@)5S@;@c@;uX @ @ $@P5S@h-5S@4 @5S@75S@٭P$@  @P5S@衭h-5S@R4 @5S@5S@臭h"@5S@ĤCÃhh 5S@P u+h"@5S@腤 @ 8@P5S@hhhhhhhKh hh5S@,5S@ͬ[fU8SVW}t+@<`e@~+@`e@k؃&@5S@5S@荒@$hT&@hHh ֈ@$h\&@hh 賈 $@@w L@2; $@=@ $@}fEfEf fEm]mEL@@$hr&@hHh 8@$hz&@hh  $@@w P@2; $@=@ $@}fEfEf fEm]mEP@hL@hh hSUS}t+ @<e@>@e@@;<@@a@@b@@a@@a@@b@@a@@b@@a@@a@Ļ@hb@Ȼ@a@̻@a@л@a@Ի@b@ػ@a@@lb@@a@ܻ@b@@a@@a@@a@@a@@b@@a@@b@@|a@@a@ @a@@b@@b@@b@@b@ @ b@$@$b@(@(b@,@,b@0@0b@4@4b@8@8b@<@8@  @P5S@|hh5S@ J}h5S@补CÃJ|5S@{@$CBPh*@h h#r@$BPh*@h hq@$APh*@h hq@$@Ph+@h-hq@$@Ph+@h-hsq@$S@Ph6+@h-hGq[ÐUS@<e@u },@e@@;<@f@+d@E@}}fEfEf fEm]mEļ@f@+d@E@}}fEfEf fEm]mEȼ@f@+d@E@}}fEfEf fEm]mEأ̼@f@+d@E@}}fEfEf fEm]mԋẸ@f@+d@E@}}fEfEf fEm]mȋE@f@+d@E@}}fEfEf fEm]mE@f@+d@E@}}fEfEf fEm]mE@f@+d@E@}}fEfEf fEm]mE@f@+d@E@}}fEfEf fEm]mEм@f@+d@E@}}fEfEf fEm]mEԼ@f@+d@E@}}f|fEf f|٭|۝xmxؼ@7hh5@;  @pÖ׃ļ@ @p讖׃ȼ@ @p虖׃̼@ @p脖׃@ @p o׃@ @p$Z׃@ @p(E׃@ @p,0׃@ @p0׃м@ @p4׃Լ@ @p8׃ؼ@.@f@PhN+@hhlN}t&5@5ļ@h`+@5c@׃+"D@ @P5S@&vhh5S@* u+h+@5S@_m5S@v5ļ@h+@h hPl5ȼ@h+@h h 3l5̼@h+@h h l5@h,@h h k5@h,@h h k5@h4,@h hk5@hJ,@h hk5@h`,@h hk @ 8@P5S@thh5S@ J}h5S@rCÃJ|5S@t@ļ@Phv,@h hj5м@h,@h-hj5Լ@h,@h-hj5ؼ@h,@h-hj[U(SVWEEEEEE@<e@u }@e@@;<@uTh-@h-@蘕׃E uh-@? u  } u ׃!hh5@ |6 @p}׃EkEXd@hh5@ +@f@Ph2-@hhkiE+;]e<ܼ@uhXސ׃ܼ@<ܼ@uhD-@T3ܼ@EkX\@t ȑ׃M؉ܼ@EkX\@t 褑׃M؉Aܼ@EkX\@t ׃M؉Aܼ@EkX\@t Z׃M؉A ܼ@EkX\@t 5׃M؉Aܼ@EkX\@t ׃M؉AkX \@DPܼ@PS׃kX \@D1Pܼ@-P2׃C;]]4ܼ@>׃ܼ@CÃ<ܼ@t|у}D@ @P5S@qhZ-@hhg 5S@ qhp-@hVdg h|-@hVQg h-@h<V>g 8@  @P5S@phFP5S@衡 +ۃP}h5S@/CÃP|5S@qp@<`e@~+@`e@k؃<ܼ@u @`e@+}2@`e@k;@k`e@;@`e@k;u[ ~W<@ @P5S@ohJV5S@诠 u+h-@5S@f5S@oܼ@Ph-@hFPeܼ@$65Ph-@hVeܼ@@$ 5Ph-@hVzeܼ@@$4Ph-@h VNeܼ@8u+ܼ@k@d ܼ@9Wh-@h%Veܼ@@ $5Ph-@h+Vdܼ@@$4Ph-@h1Vdܼ@x u+ܼ@k@d ܼ@y Wh-@h6V~dܼ@-Ph-@h<V`dܼ@Eܼ@@Eܼ@@Eܼ@@ Eܼ@@Eܼ@@ECÃ<ܼ@t ^}8@  @P5S@NmhFP5S@S +ۃP}h5S@CÃP|5S@#m<@ @P5S@l@k`e@؃<ܼ@t/hJV5S@ܝ u+h-@5S@d5S@lh-@hFP c E$t2Ph-@hVbE$O2Ph-@hVbE$*2Ph-@h Vb}u+kEd}Wh-@h%VrbE$i2Ph.@h+VMbE$D2Ph.@h1V(b}u+kEd}Wh .@h6Vb}E$a1Ph.@5c@׃ E$<1Ph..@5c@׃ }u+kEd}WE$1Ph:.@5c@貅׃E$i1PhP.@5c@荅׃ E$D1Phn.@5c@h׃ }u+kEd}WE$ 1Phz.@5c@.׃+_^[USVW++GV.@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ un<ܼ@uhX蜇׃ܼ@<ܼ@uh.@7P׃G PwPwShCÁ}u׃ }/<ܼ@t4ܼ@ǃ׃ܼ@FƁ|Ѹ_^[ÉUS]h,PEPu #׃ }=h,Phu ׃ }uuh.@h*"׃<ܼ@8+Dܼ@5S@Fh3@hV"= 8@  @P5S@FhFP5S@w +ۃP}h5S@pCÃP|5S@UF@<`e@~+@`e@k؃<@u @`e@+eE@2@x ]E@2@x(]E@2@x$]E@2@x,]E@2@x0]}@`e@k;@k`e@;@`e@k;u[ ~W<@ @P5S@EhJV5S@v u+hR3@5S@O<5S@D@PhZ3@hFP?;@xt1h V5S@u u+Dh^3@5S@;/h V5S@u u+hb3@5S@;@@P@p@phh3@hV:@2@x0$@2@x,$@2@x$$@2@x($@2@x $ht3@h!V:4CÃ<@t }tGE$E$E$E$E$h3@5c@]׃0+'8@  @P5S@ChFP5S@t +ۃP}h5S@lCÃP|5S@B<@ @P5S@B@k`e@؃<@t/hJV5S@s u+h3@5S@95S@{Bh3@hFP8 E$E$E$E$E$h3@h!V84_^[ÐUSVW++h50@5@_׃ hEP5@ b׃ @ @$@(@,@}u G<@u(h4_׃@h4|_׃@<@t <@uh4@h+@E@@E@ hu5@^׃ hXEP5@a׃ hu5@^׃ hEP5@`׃ EE܉EhEP5d׃؋CM0@M ɉH}hEP@Pc׃ @fMfH@MH@MH@MȉH @M̉H$@MЉH(@MԉH,@M؉H0@@ @@@$ @@@($@@@,(@@@0,@F|A hW5@q]׃ hD@P5@_׃ d_^[USVW}t+@<e@@e@@;<@u1S+ u@@Fƃ ~@@ihh5@V |)+F @t]׃@Fƃ~$@f@Ph4@hh4D@ @P5S@;>hh5S@?o u+h4@5S@t55S@>5@@+@Ph4@h GPZ44@'s4@h4@hGP04Ã{u_^[ÐUh5@@5@[׃ hh@5@]׃ ÉU SVWu+;]}xEEFPE @kP5S@Cn +;}}h5S@fG;}|}2}#}2}h5S@fGǃ2|C;]|8@  @P5S@<] \VS5S@m u+h5S@NfVCP5S@m u+h5S@ fkEE ;}VkEE @P5S@Rm u+h5S@e^F2;|UF ;tF;tF;tF(;tF2;uh5S@eh5S@eCÍF2;}5S@;VkEE P5S@l u+h6@5S@2_^[ÐU6@]w&6@}$hF6@h@^׃6@]w#6@}$hN6@h@|^׃z6@]w#6@}$hV6@h@K^׃I6@]w#6@}$h^6@h@^׃u uhf6@h@^׃@ÉU6@]w#6@}$hl6@h@]׃I6@]w#6@}$ht6@h@]׃u uh|6@h@y]׃@fU7@]w) 7@}5 7@$h6@h@6]׃I7@]w# 7@}$h6@h@]׃u uh6@h@\׃@ÐU,7@]w)$7@}5$7@$h6@h@\׃I7@]w#$7@}$h6@h@y\׃u uh6@h@_\׃@ÐU<7@]vu uh6@h@-\׃@47@]vu uh6@h@\׃u uh6@h@[׃@ u@0u@ @ÉUhMh5S@Ti 5S@f.hLh5S@.i 5S@@.hh5S@i }t5S@ȁ5S@.fU4Sh(EPrS׃ }+EPLS׃؋E EЉMVE̋ЋEЋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u+[ÉUSVW+h h\a@,S׃X׾ 5\a@tPBY׃ uhxT׃f@FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u,@0h8@oCÁ hx]M׃f@Oh8@ VEPh8@E uEPE׃؍EPI׃,@=,@uEE)܃ u)@ x'A  uEPh$9@ZE)܃ u)@ x'A  +ہFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uCÁ׃<ܼ@CÃX;|޸=@ k4PA׃E܉E}u{+;}"h44@u5B׃ CÃE4;|޸Ph4VuC׃EE+;}$4@=>׃E@CÃE4;|ܸ5_^[ÉU$SV]u =<@t3{8u ~8u+~8u {8u <@  $ :@V֋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^F@+C@FD+CDCD+FDCTnT :@}fEfEf fEm]mECXnX :@}fEfEf fEm]mEdC\n\ :@}fEfEf fEm]mE2F`+C`*Fd+Cd"Fh+ChFl+ClFp+Cp Ft+Ct+^[U SV]u <@  $@:@VVs;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^g+^F+CSF+CHkFd>EkCd;EEm}fEfEf fEm]mEF +C F+CkFd~ EkCd{ EEm}fEfEf fEm]mEVV-s-;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^+^[fUSV]u <@  $d:@V֋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^NF+CFF+C>F+C6FK+*F +C "F(+C(F$+C$F,+C, F0+C0+^[ULSVW+Dž<DžDžDžDž==@=@PPB׃PM;׃؋C@@C@@C @@@@@@;@@;h$@hP@@׃hhh#h"L@hh$PK;׃ +hh5@:׃ +@ h@P5@<׃ @}eP4:׃kC iiKkK<@ uC @C@C@@Gǁ@ w=@C @C@C@@u [DžJ8@ @ @P5S@}hh5S@L u+h=@5S@5S@X5S@W8@  @P5L@L@ L@+ffP5L@dL@@L@@PL@@Phh5L@- @ @ 8@P5L@hh5L@K u+h >@5L@5D@5L@V Dž38@  @P5@ @ @+ffP5@c@@@@P@@Phh5@9 @ @ 8@P5@hh5@J u+hB>@5@5D@5@bk=@;@} Dž=@k @+ȉ=@k<<;=@u 8@ @ @P5@<4@ 3sshN>@h<@ =@k+P5@a<;=@u5D@5@{<=@k;<@ @ @ 8@P5@85=@h^>@hh5@5@ThOh5S@ I 5S@T5S@8P<׃5S@8[5S@l8AupBudCuXDuL1uG5S@'85u45S@84u 0u5S@7=| KB$X=@ 0N'$<@5L@!t5@!@DžS@ S@+ffP5S@i`S@@5@APhd>@ uDžDž+=/u DžGǃP} =uՃu Phc@h~>@hP@>9׃Ph>@hP@#9׃ hhxDPhP@-9׃ }hP@h>@Dž/5@.׃hhP@4׃@Dž=@=@u{==@X=@=@k=@RuD@=<@;=@=@=@k=@5L@t5@ hi@P5@s2׃ h@hc@5@4׃  |2hi@P5@62׃ h@he@5@X4׃ e@+c@e@+c@e@+c@e@+c@ۅ@$Pr4׃=H@|t=H@}k=D@|b=D@;}Y=@@|P=@@;}G==@u H@@D@@@@@H@@D@@@@@Bu =@Eu =@=@hh$P.׃ +}DžGΈ$h=@P5L@ A u+$P5L@=5L@kL_^[U5@5@5@5@h>@hh5L@; 5@5@5@5@h>@hh5L@ hP@h>@hh5L@==@~ =@==@} =@h=@P5L@? u+%8@ @ @Ph5L@u 5L@KKÉV=@}]k@ii @k @<5@;@}&;4@u;4@B B;@|^V=@}\k@ii @k @<5@@ |$;4@u;4@~B }^Ð(Vt$0L$ƙ==@+==@ƙ==@Q+A==@ƙ==@Q+A==@q ^(ÉU@=?@}hh?@,׃?@ |X+@@hh5?@+׃ 5?@0 t"@@ tޡ@8t@̡@US@=@f=@t+ehh@u,׃ +Ft@Ù=>@@ @ @@ @D[fUSVW}u ]ECE }+I u ;EMS$ <u}~EECM;~ECEEKAu EKfUffAEKfUfAEEE;EEMS( f;׃ PS _^[ÐUSVWu ]?t1)@PWEP&׃ E}uS2 u+_^[fUSVW}u ]E @@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@}  uh@%׃ tE -E@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@} uh@$׃ tE|E$@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@}$ uh@#׃ tE$ E(@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@}( uh@"׃ tE( E,@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@}, uh@"׃ tE, E0@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@}0 uh@!׃ tE0 EECEEEEEFEE;E|hWuS3 u+ uSM, uEuuS3 u+ uS, uEEE;E}GEE;E|huVS@3 u+ u S+ uEuuS3 u+ u S+ uEEE;E}WVS2 u+ u$Sn+ uEEPVS2 u+ u(S<+ uEWEPSv2 u+ u,S + uEC t1{u+CE;@|mC E;@|\ESCECEPEPS1 u+ u0S* u=@tEECuuS1 E_^[ÉUSVW]}u fC fE5@Sj@@P@@P@@P@P@@P@@PuuWVS,EEPS E_^[ÉT$fJfD$fB fT$fbf@fB ÉUSh׃ t S@<S@=S@}&5S@׃ tS@=S@|=S@tLa@h?@׃ uLa@SV5@95@9nDPh"׃=S@t5S@ hh5@5@S@ u+<S@@=S@t5S@ hh5@5@TS@ u5S@M +=@u1=@u =@t=@t @@ @@=@u=@t@@@@aMPh5@< =@t5@!׃S@ S@=@t5@c!׃S@ S@h S@[Uh@hT5S@׃ }hf8@f?@@% @@%T@@ t@ @ÐUSV]+ u H@SS:rtFƍ@@hh5L@ʝ OuH@L@H@=@u \@@=@ @=@u @@=@ @P=(@} (@=X@ X@=@t5@7׃ t H@@=@t5@׃ t H@@@@ t+^[ÐUSVW} tQ?t?uGF4FE Q3kEK QMȋE u_^[ÉS\$Ã0| Ã9 tÃHÃa| Ãf t à %ÃA| ÃF t à +[ÐUSVW@@ tS?pK5@@ tVesN=@@ t'h@WtOG0_^[ÐUh@usfU SVWEEE E}u @+EE}u @+EEuuuu( u+EE;EEK$EMhu׃MU ufEfCSn+EK(EMhuc׃MU u&fEfCEK$4j׃S+PEK$4EK(<ƃ ǃf H@fEK$kU;rEE;E"_^[U SVW]} EEC;E0C ;E'EKS;wEEKS ;v+ uCK+E}uCK +EEuuuW u+~CM+ȉMC M+ȉME;}vSEN$UEEMK$MUEN(UEEMK(PMUEE;}wfN_^[USVW}u ] rw rv+gh0׃E u+LEEhS[׃MA$ uu ׃+EEhS+׃MA( u u׃Ep$5׃+EEhS׃MA u.u׃Ep$׃Ep(׃+EEhS׃MA uS@f @fH }tMPh5X@訞 5@.5<@-hd*G-cTh@hT5S@=׃ 5@hh# ׃ *U}t!aYb.bhSh@hT5S@׃ hhh ׃ @U,SVW]{,}u W1 uE } nt<t4t,t$+t,tt *+EE+EE=+|t2uSt5 |HC$H@E6E1E+E&EEEEEEEE=S@t W:qeYM+A,5)}u}tuuS5) uuWSy%tI@>=S@=I@t@ E@%EEt;@ @ )A@ @  AEEt E@uEES@EhyQWu E}EPRQ=S@t Wu$@ uE @;E@u =tI@@u Eu% uBE<E@u3=tI@@u*=K@t!K@@,K@K@@,@K@Eu=tI@u EtI@u)@ u@%u OEu 9}~AA A AA=|I@E A=xI@EA=|I@A A=xI@ AE@=K@K@@,f K@fK@@,f K@fHuuK@p,5K@K@@0@ K@I0IPK@@0@ K@I0 P"!!uuF !@@%E@ @ A@ @  A=S@t W u%@uE @;E u =tI@ t0E t%u0@u$@%uEtI@-@ A+ I@ @Eԋ=I@M+ȉM A+I@-@=I@EuuE4=tI@t=tI@tC" uEE=tI@t =tI@u*=K@t!K@@,K@K@@,@K@=tI@tEAEA=K@K@@,f K@fK@@,f K@fHE+APE+APK@p,5K@EAEAK@@0@ K@I0IPK@@0@ K@I0 P=S@t,@%=S@t0E u ! tEtI@Z]Q t uK$I@Т$I@=$I@t5$@{%5@k%%tI@ @uS@ %tI@_^[USV]u fEf }fff;F| fFfffEfFF }fFfFf;F| fFffFSl!Sw ^[UI@hI@hhh" +A S@@ uQ3Ai 4AxI@xI@xI@5Ai 6A|I@|I@|I@@3Ai 4AI@5Ai 6AI@/Ai 0A+I@+I@I@1Ai 2A+I@+I@I@ÉD$S@ÐU@SVW]hhS׃ Ztuu S׃ _^[ÉUhE0Epu uE0u u; ÉUS]s 3su uNsu u [fU$EEAh@A ׃ tFha׃Ph ׃AEE܃=A}tOuuu׃ E }%=F u E=FtǸ;E)EEE܃}uhhI@EP׃ uE;E u AjEEEEEt}t E܃E}tuu܍EP`׃ +EE܋EEܸ+EE=Ah<׃5Ah ׃EE tR}tLuuu׃ E }"=F u E=FtǸ'E)EEE}uEF t+ÐU5Ah ׃=At+hh@A׃ÐUSVuE I@5I@EI@ tD^S׃E ukhhI@u׃ VuEP׃ I@ESuu\ ׃ uI@;Et u ׃+^[ÉU,SVWEPhTh?׃ u}ԹffeEEXEPhTh ׃ hhJ@h ׃ uE2]hSh׃ uECCRuEPhTh׃ _^[ÉUSu׃؋E uSuh@ ׃ [fUhI@hhhZ uKEPhhJ@h ׃ hI@hhh H@EPcÉUH@ Y @@@ @ @@ @ @@ @ @@@ @@@ @+ȉ @@@mt@hd*^׃h*Q׃5@5@h׃ }hJ@h*׃=L@t/MPhh5\@5L@ P MPhh(J@֍ MPh5@轍 hd*׃fH@ Ta@|Ta@Ta@Ta@Ta@Ta@Ta@~Ta@tpTa@tbTa@tTTa@tFTa@t8Ta@t*Ta@tTa@tTa@u @@ @ÉUSH@ =@@ @@hm5@׃؍@ˊ @@ˊ )܃ u()@ x'A t@  @0|@ˊ |@@ˊ )܃ u#)@ x'A t |@  |@0h@׃@h|@׃x@=x@Z|=x@ax@ġ I@H@ H@x@@؃=x@|=x@}=@| =@| H@0x@H@ H@ @ I@H@H@ H@[ÉUSVWuFN;|,N;|=S@t~uF t+d=S@u*M=S@S@t9ǢS@=S@t% r!%=tWV]V8 t(M_^[ÐUSV]C8;X u SCAnua=]J@u@]J@s Vv;t us Vv ;t u]J@s0]s0Qs8UC0@K0I PC0K0IP5S@ S@@5S@S^[fUS] u/A[ t C-nt u=At =Au6AS@ S@+ffP5S@!'5S@S7 C,nu:=At1SC$@s$[ C-ntt=AuAË t t VWu* Eff+C fEf@f+CfC>_^[fUSVWuuu v0 F8@-y^1F0@K0I+ tC8@-yWhs0W [ t;uNj^ 1F0@ K0I + tC8@-yhWs0 [ t;uǸ_^[ÐUSVW}u ]C u+C ECEC,@+EK+;}C,@+EK+E;~E؋C,@+EK+;}C,@+EK+E;~E؋ u E_EK$UEEEMK,I$MUEK(UEEEMK,I(PMUEC;ES fs f{_^[ÉUSu(׃ }=Fu`P@[ÉUSuu u׃ } =Fuދ[ÐU=`P@t3=K@u*K@hf%t*K@`P@ÉUS] t@;tMPhSwp %hd*0CPCPhD [ÉUh@hT5S@ ׃ h@hT5S@׃ hhh׃ @fUh@hT5S@׃ 5@hh׃ 5@S@@ ;@t(5@S@@ PeS@f @fH }tS@@5S@fU=@t9f%@h@hT5S@ ׃ MPh5x@o ÐU=@tB@ f @h@hT5S@׃ MPh5|@n USVW]=Pa@t5@Pa@S@ffS@S@f@fS@S@;S@S@{uS@xu =S@C uS@xMPh5X@n +fS@fS@=S@ujS@@S@ S@+ffPS@ T@f!H MPh5@m S@ S@+ffP5S@ STC=H@u@C t h #=S@u"S@ S@+ffP5S@ f2ƋKAtPSM u+ƋKfAfFf;s|Ȁ=S@t&CPPS@PS@P {S@f S@fS@f S@fHfCf)S@fC f)S@S@ |8fS@f;C},S@ |!fS@f;C}fS@ffS@fCX+fCfMCK PKPS@PS@P$ S@fKf fS@fK fKfHS@hd*_^[ÉUtSVW]fu fEfEƋKfAfEƋKfAfEfCfEE @;u2=@t)EK  @;|f@ff+C fE=S@t!K@EK@EEf @f@EK MS@R$ EEK MS@R( AEE΋S$ EE΋S( ׃EE;HAѡHA+E HA+@AHA+@APh5@K EP׃;.;PhuU HA@A=PA}"=T@*HA+@A5X@5@A;HA}9=8@t;Ph58@gU h 5@A멡HA+@A;5@=@u =@=8@t;Ph58@T h I5@A@A;HA~E@A=@t;Ph5@T h@A;HA@A;HA=S@S@@;DAS@@ ;@A~S@@ @A+ȡS@@DA+СS@@(S@fHf;B @A DAS@R$ EE裸@@% u%@=@@% u%@=@@% u%@=@@%@@%@@%@@%@} uh@׃ t>ud=@t;Ph5@R {h3l}uX=@t;Ph5@R h@A DAS@R$ 4 u@A=@tXHA+@A =l@u?;PhHA+@APh5@G PR HA@A7=l@t;Ph5l@Q h (@A=PA}@A;HA&=TAtE@AEDAPA_^[ÃVWL$t$; @|=@-@++D$D$+_^É SVW\$fsfCfffD$f;t$~&D$KfAD$KfuF V׃\A@L@;5DL@s@L@@L@F ;5DL@r@L@DL@\A@L@Ey}t tdEh=S@EES@E}}*ǃȋEE̋EEψEЃ}|փEE Eh}uS@EES@ AEEE;E}$SE;Es EEψEЋE;E|hnEڢS@@L@;DL@S@E_^[ÐV+HL@HL@ƒ0|ƒ9k Ћ u HL@^fUES@=S@tMPh5@JJ MPh5@/J ÐD$S@ÐUhhThػ׃ USVE:S@tGES@hhh蠸׃ ؀=S@tShhz׃ ^[ÉU SVWuus@h*=h*}hd*܋P3׃ed*d*܋ΈM5@@% u%@=@@% u%@=@@% u%@=@@%E@%E@%E@%EE u+:E u+.E )D)܋ )I;)+;}Wh*=h*}hd*DP׃d*d*܊L }=Fu `P@C;|_^[ÐVP@5Q@;sD$8tƒL$D$ ^ÉUxAfA=xA}.xA xAfk MAf EAxA=xA|+,A@@@dA @@@+D@0A@4A<@8@@@+H@TA\A`AXA@$@ @+(A8A<A@ADAHALAPA@+tApA|AtAxAfT@P@AA8=tA=xAA0'pApA |vq$+m p   $[@N oSi|aSj|dmei| RI$@[@.fBcp  SeSg|Sf|?ff|  $[@; q#h$xZ@Sd| LC$Z@Sc| '"$|Y@Sb|5r 7X ka| $|DZQVTLS6S7S8|YS9|.9p2 &  eza   _K1cK5|?c5| 0 '$Y@  K2K3K4|?c4|  $X@D uc3| $X@ n&c2| SJ$lX@ / c1|  $,X@W    $X@S)|aS*|H %*/4{3jYV[`'_Ta@X(Ta@X,Ta@X0Ta@X4Ta@X8Ta@X<Ta@X@Ta@XDTa@XHTa@XLTa@XPTa@XTvTa@XXiTa@X\\Ta@X`OTa@XdBTa@Xh5Ta@Xl(Ta@XpTa@XtTa@XxTa@X|Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@ Ta@Ta@Ta@Ta@tTa@ dTa@$TTa@(DTa@,4Ta@0$Ta@4Ta@8Ta@< Ta@@ Ta@D Ta@H Ta@L Ta@P Ta@T Ta@X Ta@\t Ta@`d Ta@dT Ta@hD Ta@l4 Ta@p$ Ta@t Ta@x Ta@| Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@t Ta@d Ta@T Ta@D Ta@4 Ta@$ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@t Ta@d Ta@T Ta@D Ta@4 Ta@$ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@ Ta@  Ta@ Ta@ Ta@ Ta@t Ta@ d Ta@$T Ta@(D Ta@,4 Ta@0$ Ta@4 Ta@8 Ta@< Ta@@ Ta@D Ta@H Ta@L Ta@P Ta@T Ta@X Ta@\t Ta@`d Ta@dT Ta@hD Ta@l4 Ta@p$ Ta@t Ta@x Ta@|Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@ Ta@Ta@Ta@Ta@tTa@ dTa@$TTa@(DTa@,4Ta@0$Ta@4Ta@8Ta@<Ta@@Ta@DTa@HTa@LTa@PTa@TTa@XTa@\tTa@`dTa@dTTa@hDTa@l4Ta@p$Ta@tTa@xTa@|Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@tTa@dTa@TTa@DTa@4Ta@$Ta@Ta@Ta@Ta@Ta@Ta@Ta@ Ta@Ta@Ta@Ta@tTa@ dTa@$TTa@(DTa@,4Ta@0$Ta@4Ta@8Ta@<Ta@@Ta@DTa@HTa@LTa@PTa@TTa@XTa@\tTa@`dTa@dTTa@hDTa@l4Ta@p$Ta@tTa@xTa@|Ta@Ta@Ta@Ta@Ta@Ta@Ta@Ta@wTa@jTa@]Ta@PTa@CTa@6Ta@)Ta@Ta@Ta@+ۃ>t tS6׃S!׃^[UTa@ tNTa@PhTTa@PS׃ A;AthAh}tTa@P'ÉT$BȁuuȋUSVW}uhd]@{׃E}t E u j]@EDžphr]@f{׃ tdVEP{׃E@MQ{׃@4F/FM F/uVO{׃hEPW׃pp}Zh|]@EP{׃E@MQ{׃@4EFuVz׃hEP׃pphh]@|׃ t }uh]@׃fE[}uLhh]@hK׃ uyz׃Puh/׃ hh]@h׃ E}uh׃ _^[Ã=`]@t,=Ta@t#hh|׃Ta@DžP!xATa@`]@xAP} uu ́׃ uE Ta@fM f!}t EhhxAps׃ tp|׃t6hh]@h ׃ }uh~׃ _^[Átu6hh]@hʉ׃ }uh}׃ _^[Í5AxASd^SdSo`S]\SKX`|\| X'}t}u[hh^@h׃ EP詆׃PEPh׃ h3h^@hɈ׃ h|׃E_^[STPuT苀׃Pdd t FC Ta@HTa@CG;Hs FG`` uыà tCáTa@(HTa@L:fSDL;HsLLfDf\\ uhlu X׃lhcu B׃hl t#Ta@@ly׃@fAh t#Ta@@hx׃@fATa@HTa@(LYStL;Hs9tuLLLLtPXX uP FC TT uTa@%u5Ta@fTa@ǀ@Ta@@(B+_^[ÍtPh|t@Ta@P }׃ t +_^[fUTa@ t%Ta@PhTTa@P|׃ hh#Ah|t@Ta@P|׃ h#Ad#Ad#A;h#Athd#Ah}tTa@Ps|ÉUVWTa@PhTTa@PH|׃ Ta@ u Ta@ Ta@f_^fUSu uu [ÉUSVWDžl]5l#ADžT}uhJ`@o _^[#AC 4 %t Fψ⋅lp\0uCËC ]$^@\ \d3uCdthT`@_^[ËFH\=^@0H\d\\d}2uCdthf`@m_^[ËFH\=^@0HFH\=^@0Hll\ tttDž\Tt Ta@@TTa@HȋAlLTt=Lt4Ta@@;\~ Ta@xtt\Ta@@tLLt'Ta@M;HPuLh#Aq׃\F\llllpLllHLIq׃HpllpLL8FLL ܋Fψ4E E)C $^@llM pllMpllMpllMpllMprllM pZllM$pBllM(p*llM,phx`@x_^[Ã1TCllpLllC LpllC pC'h`@_^[Dž\DžX-uDžXC +uCÐC0|9k\ ǃЉ\ڃ}th`@k_^[ll\Xpllpllp\ll\pllpllp\ll\+ωpBllpllp\ll\pllpllp\llH\Hpllpllp\llH\Hp=llpllp\ll#\pllpllp\ll \pllpllp\ll3\pSllpllp\ll;\ɉpllpllp\ll;\ɉpllpllp\ll;\ɉp]lȃpɉp;lȋpщpllpuAheS[h;SFh`@)_^[h#AVVj׃l#A_^[f+ÐUSVWu+F t?Ã%uF:] tÃ;u u_^[Ã?uGÃ;uh`@_^[ÉUS] t9;t3$uCu C u!EEPUE_^[Ë_^[áTa@xt_^[uV _^[ÐU SVW]Ta@E~}| _^[ËE4Ea@ƙ=$a@ءTa@tTa@+Ù ~WU  +_^[Ð     ]))))))))))))))))))))))))))))))))))))))))))))) ))) ) )))l) 2  <]<l)))))))))))) d(@2@6@>@D@H@P@R@Z@b@h@j@p@r@x@z@|@~@@@@@@@@@@@@@   j@@@@@@@@@@@@@j@D< ?M`RVeZlqw@(#)rtmc.c 1.2 AIXHOME$HOME variable not present.%s/rtmcmkdir%s/%s%s/%s.dump%s/%s.%02dopenopenopenwritemalloc: out of memorywritewriteAre you sure? (y/n) Dump disabledDump enabledwaCan not connect%s; Press any key to continue.%.2d/%.2d/%.2d %.2d:%.2d:%.2dLOCwriteopenwritewriteThank you for using RTM/AIX. SNAPSHOTCPUMEMORYDASDI/ONETWORKSYSCALLPAGINGCACHEMBufQUEUETABLEPARAMETERsysinfominfoinodefileprocvmaxmemphysmemnswapavenrunifnetmbstat@(#)init_cur.c 1.2 AIXpBB@(#)kernel.c 1.2 AIXuname%s: %s v %s %s/unixnlist/dev/kmemopend@(#)prt_scr.c 1.3 AIX%sREAL TIME MONITOR/AIX%.2d/%.2d/%.2d %.2d:%.2d:%.2dLOC%.2d:%.2d:%.2d%.2d:%.2d:%.2dLOCRMTHISCUR/\\/ Q-Quit D-Dump F-Force H-Help N-Chg. Node O-Option T-Time $&&&&&&&&&&&&&&&%%%%%%%%%%&&&&&&&&&O$$&&&&&&&&&&&&$@(#)options.c 1.2 AIX Enter a number... D - Default Q - Return OPTION DEFINITION SCREEN %10d%10dScreen refresh intervals (seconds): -> %10d Screen dump intervals (seconds): -> %10d History save intervals (seconds): -> %10d@@@@@@@@:@@@X@\@j@n@@@@@@@@@@@B@F@d@h@@@@@@@@ @*@0@>@D@Z@^@x@~@@@@@@@,@4@Z@b@r@z@@@@@@@"@,@V@^@@@@@@@ @*@N@X@t@~@@@@@@@ @ @B @L @r @| @ @ @ @ @!@ !@@(#)help.c 1.2 AIX GENERAL HELP SCREEN 1..9 - Go to display by highlighted number? - Explain commands and screen variablesC - Clear screenD - Dump to file/printerE - Exception conditions, not availableF - Force RTM to read kernel, instead of waiting for time to expireG - Select display to go to,L - Change to display on the leftN - Set up node table, select current nodeO - Set optionsP - Change to the previous displayQ - Quit Real Time Monitor,R - Change to display on the rightS - Select sorted byT - Toggle current time/sample period,U - Change to parent displayV - View historical data,[Enter] - Go to the selected sub-display [Space] - Move cursor to a sub-display if available[PgUp]/[PgDn] - Previous/Next page if multiple pages to display Q - Return ?No help for %s, %s: %s, Hit any key to continueLOCLocal host information is displayedCURCurrent host infomation is displayedRMTRemote host information is displayedHISHistorical data is displayed#USRCurrent number of usersIDL% of cpu idleUSR% of cpu in user modeSYS% of cpu in kernel modeWIO% of cpu waiting for I/O1MINAverage CPU loads of last minute5MINAverage CPU loads of last five minute15MINAverage CPU loads of last fifteen minuteMEMCurrent free memory in pagesSWPCurrent free swap in pagesPF/SAverage page faults per secondCHARIOAverage character I/O per secondPACKETIOAverage network packet I/O per secondIF NAMENetwork interface device nameQLENQueue lengthMAXQMaximum queue lengthMTUMaximum transmission unitPIN/SAverage incoming packets per secondPOT/SAverage outgoing packets per secondPIE/SAverage incoming packet errors per secondPOE/SAverage outgoing packet errors per secondCOLL/SAverage packet collisions per secondMACHIDHOST node nameIGET/SAverage iget() calls per secondNAMEI/SAverage namei() calls per secondDIRBLK/SAverage dirblk() calls per secondBREAD/SAverage blocks read into cache per secondBWRITE/SAverage blocks write out cache per secondLREAD/SAverage logical reads from cache per secLWRITE/SAverage logical writes to cache per secPHREAD/SAverage physical reads from DASD per secPHWRITE/SAverage physical writes to DASD per secPSWITCH/SAverage process switchs per secondSWAPIN/SAverage swapins per secondSWAPOUT/SAverage swapouts per secondBSWAPIN/SAverage swapins per secondBSWAPOUT/SAverage swapouts per secondREADCH/SAverage character read per secondWRITECH/SAverage character write per secondRCVINT/SAverage receive interrupts per secondXMTINT/SAverage transmit interrupts per secondMDMINT/SAverage modem interrupts per secondRAWCH/SAverage transmit interrupts per secondSVRMIG/SAverage migrates from other sites per sec@(#)goto.c 1.3 AIX A-Abort [Space]-Next [Enter]-Select SCREEN MAP @(#)rtmc_svc.c 1.2 AIXtcprtmcd@(#)dump.c 1.2 AIXRTM/AIX dump at %.2d/%.2d/%.2d %.2d:%.2d:%.2d, Sampling interval from %.2d:%.2d:%.2d to %.2d:%.2d:%.2d MACHID - %s --------------- @(#)scr_main.c 1.2 AIX%d Welcome to the Real Time Monitor / AIXzD??Y@<@(#)snap_shot.c 1.2 AIX CPU % LOADS MEMORY I/O & NET [MACHID] #USR IDL USR SYS WIO 1MIN 5MIN 15MIN MEM SWP PF/S CHARIO PACKETIO[PgUp]%-12.12sNot Selected;Not Connected;%4ld%4ld%4ld%4ld%4ld%s%s%s%s%s%s[PgDn]d?Y@HBB@(#)scr_cpu.c 1.3 AIX%s not available.CPU Usage - Idle: %3ld%%, User: %3ld%%, Kernel: %3ld%%, Wait: %3ld%% CPU USAGE CPU Idle: %3ld%% CPU User: %3ld%% CPU Kernel: %3ld%% CPU Wait: %3ld%% %d %s not available.System Calls - reads/s: %d, writes/s: %d, forks/s: %d, execs/s: %d, total: %d SYSTEM CALLS Read()s/s:%5dWrite()s/s:%5d Fork()s/s:%5d Exec()s/s:%5d Others/s:%5dSyscalls/s:%5d%s not available.Process Queues - runque: %5.1f, runocc: %4.0f%%, swapque: %5.1f, swapocc: %4.0f%% PROCESS QUEUES %4.0f%% Run Queues: %5.1f %4.0f%%Swap Queues: %5.1f %s not available SYSTEM PARAMETERS ndevs: %5dcall: %5d/%5dclist: %5dfile: %5d/%5dinode: %5d/%5dlock: %5dmount: %5d/%5dnetmsg: %5dpidsite:%5dplist: %5d/%5dpmount: %5d/%5dproc: %5d/%5drwake: %5drsleep: %5dsites: %5dtcbtab: %5d/%5dtcbloci:%5d/%5dbuf: %5ddcbuf: %5dpbuf: %5dhbuf: %5dhmask: %5dhino: %5dhimask: %5dhproc: %5dhpmask: %5dhsleep: %5dhsmask: %5dhdcbuf: %5dhdcmask:%5drsel: %5dhmount: %5dhmmask: %5dmaxup: %5dnswapmap:%5dnswbuf: %5dpcklist: %5dmalloc: out of memory%s not available.System Table - Inode: %d/%d, File: %d/%d, Process: %d/%d Process State - Sleep:%d, Wait:%d, Run:%d, Idle:%d, Zombie:%d, Stop:%d, Xbrk:%d SYSTEM TABLES Inode:%5d/%5d %3d%% File:%5d/%5d %3d%% Proc:%5d/%5d %3d%%Sleep Wait Run Idle Zombie Stop Xbrk%5d?BHBY@@(#)scr_mem.c 1.2 AIX%s not availableMemory Usage - Free memory: %ld/%ld=%3.0f%%, Free swap: %ld/%ld=%3.0f%% MEMORY USAGE Free Memory:%3.0f%% Free Swap: %3.0f%% Free Memory: %5s pagesMaximum Mem: %5s pagesPhysical Mem:%5s pagesFree Swap: %5s pagesMaximum Swap:%5s pages1 page = %5s bytes%s not availablePage Faults - Protection faults/s: %ld, Validity faults/s: %ld PAGING Protection faults/s: %5ld Copy on write: %5ld Steal page: %5ldValidity faults/s: %5ld Demand paging: %5ld Page in cache: %5ld Page on swap: %5ld Page on file: %5ldTotal Page Faults/s: %5ldfreed pages: %5ldunmodified pgs on swap:%5ldunmodified pgs on file:%5lddY@@(#)scr_dasd.c 1.2 AIXr/etc/mtabcan't read /etc/mtab%s not availabel.malloc: out of memory DASD USAGE FilesystemsTotal Used Free %%usd Inode Used %%usdMounted on[PgUp]%s%s%s%s%3d%%%s%s%3d%%%s[PgDn]Total%s%s%s%3d%%%s%s%3d%%DASD Usage - Total: %s, Used: %s, Free: %s, %%usd: %d Inode - Total: %s, Used: %s, Free: %s, %%usd: %d nfsmalloc: out of memory%s (%s) is not mounted%s not available.Cache Hit - Read: %d/%d %.1f%%, Write: %d/%d %.1f%%. (buffer/logical) BUFFER CACHE Read/s:%4d/%4d %3.0f%%Write/s:%4d/%4d %3.0f%%Cache Hit Ratio# of Buffers: %5d# of Hash Queues: %5dBuffer Block Size:%5d@(#)scr_io.c 1.2 AIX%s not available I/O iget/s: %5ldnamei/s: %5lddirblk/s: %5ldbread/s: %5ldbwrite/s: %5ldlread/s: %5ldlwrite/s: %5ldphread/s: %5ldphwrite/s: %5ldpswitch/s: %5ldswapin/s: %5ldswapout/s: %5ldbswapin/s: %5ldbswapout/s:%5ldreadch/s: %5ldKreadch/s: %5ldwritech/s: %5ldKwritech/s: %5ldrcvint/s: %5ldxmtint/s: %5ldmdmint/s: %5ldrawch/s: %5ldcanch/s: %5ldoutch/s: %5ldmsg/s: %5ldsema/s: %5ldbirths/s: %5lddeaths/s: %5ldbreada/s: %5ldrmtread/s: %5ldrmtwrite/s:%5ldrmtfork/s: %5ldrmtexec/s: %5ldrmtrun/s: %5ldrmtmig/s: %5ldsvrread/s: %5ldsvrwrite/s:%5ldsvrfork/s: %5ldsvrexec/s: %5ldsvrrun/s: %5ldsvrmig/s: %5ldB@(#)scr_net.c 1.2 AIXifcur: malloc error%s not available.ifcur: malloc error NETWORK IF Name U/D QLen MaxQ Mtu Pin/s Pot/s Pie/s Poe/s Coll/s[PgUp]%sUpDown%5d %5d%7d%8.1f%8.1f%8.1f%8.1f%8.1fNetwork I/O - packet i/o: %.1f/%.1f, error i/o: %.0f/%.0f, collision: %.0f [PgDn]Total%8.1f%8.1f%8.1f%8.1f%8.1fifrec: malloc error4@4@4@ 5@$5@:5@R5@ l5@5@ 5@ 5@ 5@ 5@%s not available. MBuf Usage %d/%d mbufs in use:%5d mbufs allocated to %sdatapacket headerssocket structuresprotocol control blocksrouting table entriesIMP host table entriesaddress resolution tablesfragment reassembly queue headerssocket names and addresseszombie process informationsocket optionsaccess rightsinterface addresses@(#)rtmc_util.c 1.2 AIX0 20 40 60 80 100%%4.0fM%4.1fM%4.0fK%4.1fK%5.0f%4.0fM%4.0fK%5.0f%4.0fG%4.0fM%4.0fK%4.0fM%4.0fK%5.0f%5.2f%5.1f%5.0f@@@.AcA@@@.AcA@@cA@@cAY@$@ +if)@(#)node_setup.c 1.2 AIXnodes: malloc error Q-Quit A-Add D-Delete T-Toggle [Space]-Cursor [Enter]-Select [PgUp/PgDn] NODE LIST %3d: %-40.40sLocal Active [PgUp][PgDn]Enter a host name to add: Invalid host name: Duplicate host name: malloc: out of memoryOut of host table entry.Can't delete the last nodeEnter a host name or number to delete: Invalid host name: Selection out of rangeCan't delete the local nodeDelete %s, are you sure? (y/n) %s%s; Press any key to continue;@;@;@;@;@;@;@;@;@<@;@*;@0;@4;@@;@F;@L;@R;@X;@\;@b;@j;@n;@B4fnv~r{/t;@;@;@;@;@;@;@;@;@@(#)sort_list.c 1.2 AIX Q-Abort [Space]-Next [Enter]-Select [MACHID] #USRIDL CPU BUSY 1MIN5MIN15MINMEM SWPPF/SCHARIOPINPOUTFilesystems Total Used Free%usd InodeUsed%usdMounted onIF Name U/D QLen MaxQ Mtu Pin/s Pot/s Pie/s Poe/s Coll/spBu & n 7 - u <@(#)view_hist.c 1.2 AIX Enter reviewing period. Q-Return F-File L-List V-View B-Begin E-End SET UP HISTORY REVIEW HISTORY %.2d:%.2d:%.2d %2d Enter history file name: %s/%s%sFile doesn't exist: %d:%d:%d Interval begins: %.2d %.2d:%.2d:%.2d ends: %.2d %.2d:%.2d:%.2d%sD@(#)getnuser.c 1.2 AIX/local/utmp@(#)chgat.c 1.6 AIX@(#)clrtoeol.c 1.5 AIX@(#)mvprintw.c 1.4 AIX@(#)printw.c 1.6 AIX@(#)addstr.c 1.5 AIX@(#)box.c 1.6 AIX@(#)standout.c 1.4 AIX@(#)initscr.c 1.13 AIXTERM@(#)cr_tty.c 1.13 AIXam@bs@bw@da@db@eo@es@hs@hz@in@km@mi`@msd@nch@osH@ul,@xn @co@itX@li\@lm@sg(@pbL@vt@ws@al@as@ae@bc@bl@bt@cdP@ce@chT@clX@cmL@cr<@cs@@cvD@dc @dl$@dm(@do,@DO@ds0@ec@ed4@ei8@fs@ho@ic@im@ip@k00@k14@k28@k3<@k4@@k5D@k6H@k7L@k8P@k9T@k;@k<@k>@Sa@Sb@Sc@Sd@Se@Sf@Sg@Shx@Si|@Sj@Sk@Sl@Sm@Sn@So@Sp@Sq@SrP@SsT@StX@Su\@Sv`@Swd@Sxh@Syl@Szp@S!t@S#(@S$,@S%0@S&4@S(8@S)<@S*@@S+D@S,H@S-L@S.@S/@S:@S; @S<@S=@S>@S?@S@ @S[$@S]@S^@S_@S{@S1@S2@S3@S4@S5@S6@S7@S8@S9@SA@K1X@K2\@K3`@K4d@K5h@Krl@KR@Ksp@KS@Ktt@KT@Kux@KU@Kv@KV@Kw@KW@Kx@KX@Ky@KY@Kz@KZ@ka@kA@kb@kc@kC@kD@kd@ke@kE@kF|@kH@kh@ki@kI@kL@kl@kM@kn @kN,@ko@kO@kp@kP$@kq@kQ@kr@kR@kS@ks@kt@kT@ku@kU@kv(@kV @kw@kW@kz@kZ@le@LE@ll@ma@mb@md@me@mh@mkt@mmx@mo|@mp@mr@ndl@nlp@pc@RI@se@sfP@so@sr4@ta8@te<@ti@ts@@ucD@ue@up0@UP@us@vb@ve@vi @vs$@bx@by@Bx@By@c0\@c1`@c2d@c3h@c4l@c5p@c6t@c7x@d0|@d1@d2@d3@d4@d5@d6@d7@f0@f1@f2@f3 @f4@f5@f6@f7@za@+-+|++-|-|+xx@(#)newwin.c 1.5.1.6 AIX@(#)delwin.c 1.5 AIX@(#)tstp.c 1.6.1.1 AIXsrc.com/lib/libcurs/libcur/endwin.c@(#)csavetty.c 1.2 AIX!LLLLLLLLLL:D  `@@(#)'src.com/lib/libcurs/libcur/ecpnin.c, bos, 130, 0012' 1.2 AIX  BI@ A$ @I@@m Couldn't restore colors @(#)getch.c 1.5 AIX@(#)ecrfpn.c 1.4 AIX@(#)ecrfpl.c 1.4 AIX@(#)ecrefpan.c 1.3 AIX@(#)overput.c 1.4 AIX@(#)addch.c 1.3.1.5 AIX@(#)chkscroll.c 1.5 AIX@(#)move.c 1.4 AIX@(#)scroll.c 1.4.1.1 AIX@(#)ecloct.c 1.3 AIX@(#)ecpspn.c 1.4 AIX@(#)ecscpn.c 1.4 AIX@(#)vscroll.c 1.4 AIX@(#)eciorc.c 1.7 AIX @(#)clrtobot.c 1.5 AIX@(#)do_attr.c 1.4 AIX@(#)cr_put.c 1.8 AIX@(#)touchwin.c 1.5 AIXF@(#)keypad.c 1.8 AIX\A\A@@@@@l@p@t@x@@!@"@#@$(@% @&@'@)@*@,@+@(@-@. @/@@@@@@0@4@8@<@@@D@H@L@P@T@@@@@@@@@@@x@|@@@@@@@@@P@T@X@\@`@d@h@l@p@t@(@,@0@4@8@<@@@D@H@L@@@@ @@@@@ @$@@@@@@@ @ @ @ @ @@|@@,@$@@@@@@@@@@@@@@@X@\@`@d@h@ @@@@@@@@@@(#)eciopc.c 1.3 AIX@(#)set_attr.c 1.6 AIXmbdAmd @mh@mk@mr@us@so@c0 @c18@c2<@c34Ac4@c50Ac6D@c7@d0$@d1@d2XAd3`Ad4\Ad5TAd6H@d7@f0PAf1LAf2HAf3DAf4@Af5<Af68Af7(A ERROR in setup_attr()-ignore QQQ4QRQW{WjWYWHW7W&WWWWVVVVVVVrVWW^VJV6V"VVUUUWWUUUUnUZUFU2UYYYYYYxYlYYY`YTYHY9Y*YY YXYYXXXXXXXXYYvXgXXXIX:X+XX X@(#)ttyctl.c 1.4 AIX@(#)curses.c 1.4 AIX@(#)unctrl.c 1.4 AIX^@^A^B^C^D^E^F^G^H^I^J^K^L^M^N^O^P^Q^R^S^T^U^V^W^X^Y^Z^[^\^]^~^_ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~^?T@ T@$T@(T@,T@0T@4T@8T@U@@U@BU@DU@FU@HU@JU@LU@NU@PU@RU@TU@VU@XU@ZU@@(#)ecrmpl.c 1.4 AIX@(#)ecactp.c 1.4 AIX@(#)ecobsc.c 1.4 AIXdddcddAcddddcdcddddddddb{W{YW|YYYYvw{g{Yg|YYuY'vwYYYYYy{w{Yw|YYYYGvwYYYYYy|{Y|YY'uYWvwYYYYYy|{Y|YYYYgvw'|{Y|YYYYwvxuwYYYYYY7zgzYYYYYg~YYYY7YYYYYYYYYYYZsWtYYYGuY|YYYYxYyzYzYYYYGYYYYYYYYYYrYtYYsYYuYs&sYYYYWYYYYYYYYgtYrYYYYYYYwrwtYYYYYtttstYY7uYYYYYYwyYyztYYYYY|YYYYYYYYsYrWzgYYYYǃYYYYYYYYWuVrrgsYYYYYYv3sYYYGyrYYYrYY}YWxYYyYY7tguYW}YtYYYYyYY@s~YYYYYYY׀YYYY%YYYYYYYYsYprwsYtYYuYwYYYYgyYYYwzGtMs@(#)resetshell.c 1.6 AIX@(#)setupterm.c 1.12 AIXTERMunknownTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/./usr/lib/terminfo/.No such terminal: corrupted term entry term entry too long Terminfo binary is incompatible with current term.h: Recompile @(#)reset_prog.c 1.6 AIX@(#)def_shell.c 1.5 AIX@(#)tgoto.c 1.5 AIX d^yʐ*$'"Ԓq4ݍcFhÔÍw0̓;Ku)@(#)tparm.c 1.12 AIXnull argbad char after %3bad char after %2bad parm numbermissing closing quotemissing closing bracebad % sequenceno matching ENDIF@(#)tputs.c 1.6 AIX@(#)_delay.c 1.5 AIX5MS7) @(#)curses.c 1.5 AIXunknown @a@xAHa@/shlib/libc_s2c4 kl$@fA++毄-@./usr/man/cat1/cp.1386. CP, COPY(1,C) AIX Commands Reference CP, COPY(1,C) ------------------------------------------------------------------------------- cp, copy PURPOSE Copies files. SYNTAX one of +------+ +--------+ +- infile --- directory -+ | cp |---| +----+ |---|^ | |---| | copy | +-| -f |-+ |+---------+ | +------+ ^| -i || +-- infile --- outfile --+ || -p || || -r || || -- || |+----+| +------+ Note: This command does not have MBCS support. DESCRIPTION The cp (copy) command copies a source file or the files in a source directory to a target file or directory. If your output is to a directory, the files are copied to that directory with the same file name. If infile is a symbolic link, the link is followed when the copy is performed. If the link cannot be followed, an error is indicated. If infile is a hidden directory, a component in that directory is selected. If no selectable component is present, an error is indicated. If outfile is a symbolic link, it is followed when the copy is performed. If outfile is a hidden directory, a component in that directory is selected. If the standard input is a work station, the user is asked if that component should be overwritten before the copy is performed. No questions are asked if the -f option is given. Components of hidden directories are not created implicitly by the cp command. If no selectable component is found in the hidden directory, an error is indicated. Hidden directory components may be created only by cp using the '@' character syntax. You can also copy special device files. If the file is a named pipe, the data in the pipe is copied into a regular file. If the file is a device, the file is read until the end of file is reached and that data is copied into a regular file. Processed October 22, 1992 CP, COPY(1,C) 1 CP, COPY(1,C) AIX Commands Reference CP, COPY(1,C) Notes: 1. Do not name outfile as one of the input files. 2. If you specify a directory for the outfile, the directory must already exist. 3. If the infile contains subdirectories and the subdirectories do not exist, the system creates them. FLAGS -f No questions asked if outfile is a hidden directory. -i Prompts the user with the name of the file whenever the copy will cause an existing file to be overwritten. An answer of y causes the cp command to continue. Any other answer prevents it from overwriting the file. -p Preserves the modification times and modes of the infile for the copy. -r Copies each subtree rooted at the infile (recursive copy). If the infile is a directory, the outfile must be a directory. -- Indicates that the arguments following this flag are to be interpreted as file names. This null flag allows the specification of file names that start with a (minus). EXAMPLES 1. To make another copy of a file in the current directory: cp prog.c prog.bak This command copies the file "prog.c" to the file "prog.bak". If the file "prog.bak" does not already exist, the cp command creates it. If the file "prog.bak" does exist, the cp command replaces it with a copy of "prog.c". 2. To copy a file to another directory: cp jones /u/nick/clients This command copies the file "jones" to the file "/u/nick/clients/jones". 3. To copy a file to a new file and preserve the modification date and time: cp -p smith smith.jr This command copies the file "smith" to the file "smith.jr". Instead of creating the file with the current date and time stamp, the system gives the file "smith.jr" the same date and time as the file "smith". 4. To copy the files and subdirectories in a directory to another new directory (target directory does not previously exist): cp -r /u/nick/clients /u/nick/customers Processed October 22, 1992 CP, COPY(1,C) 2 CP, COPY(1,C) AIX Commands Reference CP, COPY(1,C) This command creates the new directory "customers" containing copies of the files, subdirectories, and files rooted at the directory "clients". If "/u/nick/customers" already exists, this command creates a directory "clients" within the directory "customers". 5. To copy a specific set of files to another directory: cp jones lewis smith /u/nick/clients This command copies the files "jones, lewis," and "smith" to the directory "/u/nick/clients". 6. To use pattern-matching characters to copy files: cp programs/*.c . This command copies the files that end with ".c" that are located in the directory "programs" to the current directory (.). You must type a space between the "c" and the final period. 7. If the infile is a named pipe, the cp command will block until another process opens the named pipe for writing, writes to it, and then closes the named pipe. Users may want to check for named pipes in the set of input files before invoking cp. RELATED INFORMATION See the following commands: "cpio," "link, unlink," "ln," and "mv, move." Processed October 22, 1992 CP, COPY(1,C) 3 kF#$.A++毄-../usr/man/cat1/find.16. FIND(1,C) AIX Commands Reference FIND(1,C) ------------------------------------------------------------------------------- find PURPOSE Finds files matching expression. SYNTAX find --- path --- expression ---| ^ | +--------+ find --- pattern ---| Note: The find command should be used in conjunction with the "- print" option. DESCRIPTION The find command recursively searches the directory tree for each specified path, seeking files that match a Boolean expression written using the terms given below. The output from the find command depends on the terms used in expression. When searching a directory tree, symbolic links are treated as terminal nodes even when they point to directories. The exception is when path is a symbolic link that points to a directory, in which case that directory tree will be searched. The second form rapidly searches a data base for all pathnames which match pattern. Usually the data base is recomputed weekly by the updatedb script which is run from the /usr/adm/weekly shell script. The data base contains the pathnames of all files which are publicly accessible. If escaped, normal shell "globbing" characters (* , ?, [, ] may be used in pattern, but the matching differs in that no characters (for example, /) have to be matched explicitly. As a special case, a simple pattern containing no globbing characters is matched as though it were *pattern*; if any globbing character appears, there are no implicit globbing characters. EXPRESSION TERMS In the following descriptions, the parameter num is a decimal integer that can be specified as +num (more than num), -num (less than num), or num (exactly num). Processed April 19, 1993 FIND(1,C) 1 FIND(1,C) AIX Commands Reference FIND(1,C) -fstype type True if the file system to which the file belongs is of the type type, where type is typically nfs or ufs. -inum n True, if file has inode n. -name file True, if file matches the file name. You can use pattern-matching characters, provided they are quoted. In an expression such as [a-z], the minus means "through" according to the current collating sequence. A collating sequence may define equivalence classes for use in character ranges. See "Introduction to International Character Support" in Managing the AIX Operating System for more information on collating sequences and equivalence classes. -perm onum True, if the file permission code of the file exactly matches the octal number onum (see "chmod" for an explanation of file permissions). The onum parameter may be up to three octal digits. If you want to test the higher-order permission bits (the set-user-ID bit or set-group-ID bit, for example), prefix the onum parameter with a minus (-) sign. This makes more flag bits significant (see the stat system call for an explanation of the additional bits), and also changes the comparison to: (flags"&"onum)==onum -prune Always yields true. Has the side effect of pruning the search tree at the file. That is, if the current path name is a directory, find will not descend into that directory. -type type True, if the file type is of the specified type as follows: b Block special file c Character special file d Directory f Plain file h Hidden directory l Symbolic link p FIFO (a named pipe). s Socket -links num True, if the file has num links. See "ln." -user uname True, if the file belongs to the user uname. If uname is numeric and does not appear as a login name in the /etc/passwd file, it is interpreted as a user ID. -nouser True, if the file belongs to a user not in the /etc/passwd data base. Processed April 19, 1993 FIND(1,C) 2 FIND(1,C) AIX Commands Reference FIND(1,C) -group gname True, if the file belongs to the group gname. If gname is numeric and does not appear in the /etc/group file, it is interpreted as a group ID. -nogroup True, if the file belongs to a group not in the /etc/group data base. -size num True, if the file is num blocks long (512 bytes per block). For this comparison the file size is rounded up to the nearest block. -atime num True, if the file has been accessed in num days. -mtime num True, if the file has been modified in num days. -ctime num True, if the file inode has been changed in num days. -exec cmd True, if cmd runs and returns a zero value as exit status. The end of cmd must be punctuated by a quoted or escaped semicolon. A command parameter "{}" is replaced by the current path name. -ok cmd The find command asks you whether it should start cmd. If your response begins with "y", cmd is started. The end of cmd must be punctuated by a quoted or escaped semicolon. -print Always true; causes the current path name to be displayed. The find command does not display path names unless you specify this expression term. -hidden Always true; causes hidden directories encountered in the descent to be treated as directories and their contents searched. Otherwise, hidden directories are treated as ordinary files and are not searched. -cpio device Write the current file to device in cpio format. See "cpio." -newer file True if the current file has been modified more recently than the file indicated by file. -depth Always true. This causes the descent of the directory hierarchy to be done so that all entries in a directory are affected before the directory itself. This can be useful when find is used with cpio to transfer files that are contained in directories without write permission. -ls Always true; causes current pathname to be printed together with its associated statistics. These include (respectively) inode number, size in kilobytes (1024 bytes), protection mode, number of hard links, user, group, size in bytes, and modification time. If the file is a special file, the size field will instead contain the major and minor device Processed April 19, 1993 FIND(1,C) 3 FIND(1,C) AIX Commands Reference FIND(1,C) numbers. If the file is a symbolic link, the pathname of the linked-to file is printed preceded by "->". The format is identical to that of "ls -gildsN" (note however that formatting is done internally, without executing the ls.) -xdev Always true; causes find not to traverse down into a file system different from the one on which current argument pathname resides. This is helpful in instances where there are multiple remotely mounted filesystems that might take too long to search. \( expression \) True, if the expression in parentheses is true. You may perform the following logical operations on these terms (listed in order of decreasing precedence): o Negate a term (! is the NOT operator). o Concatenate terms (juxtaposing two terms implies the AND operation). o Alternate terms (-o is the OR operator). EXAMPLES 1. To list all files in the file system with a given base file name: find / -name .profile -print This command searches the entire file system and writes the complete path names of all files named ".profile". The "/" tells the find command to search the root directory and all of its subdirectories. This may take a while, so it is best to limit the search by specifying the directories where you think the files might be. 2. To list the files with a specific permission code in the current directory tree: find . -perm 0600 -print This command lists the names of the files that have only owner-read and owner-write permission. The "." (dot) tells find to search the current directory and its subdirectories. See the command: "chmod" for details about permission codes. 3. To search several directories for files with certain permission codes: find manual clients proposals -perm -0600 -print This command lists the names of the files that have owner-read and owner-write permission and possibly other permissions. The directories "manual", "clients", and "proposals", and their subdirectories, are searched. Note that "-perm 0600" in the previous example selects only files with permission codes that match "0600" exactly. In this example, "-perm -0600" selects files with permission codes that allow at least the Processed April 19, 1993 FIND(1,C) 4 FIND(1,C) AIX Commands Reference FIND(1,C) accesses indicated by "0600". This also matches the permission codes "0622" and "2744". 4. To search for regular files with multiple links: find . -type f -links +1 -print This command lists the names of the ordinary files ("-type f") that have more than one link ("-links +1"). Every directory has at least two links: the entry in its parent directory and its own "." (dot) entry. See "ln" for details about multiple file links. 5. To back up selected files in cpio format: find . -name "*.c" -cpio /dev/rfd0 This command saves all the ".c" files onto the diskette in cpio command format. See "cpio" for details. The pattern "*.c" must be quoted to prevent the shell from treating the * as a pattern-matching character. This is a special case in which the find command itself decodes the pattern-matching characters. 6. To perform an action on all files that meet complex requirements: find . \( -name a.out -o -name "*.o" \) -atime +7 -exec rm {} \; This command deletes ("-exec rm {} \;") all files named "a.out" or that end with ".o", and that were last accessed over seven days ago ("-atime +7"). The "-o" flag is the logical OR operator. FILES /etc/group File that contains all known groups. /etc/passwd File that contains all known users. RELATED INFORMATION See the following commands: "cpio," "sh, Rsh," and "test." See the stat system call and the cpio command and fs files in AIX Operating System Technical Reference. See the "Introduction to International Character Support" in Managing the AIX Operating System. Processed April 19, 1993 FIND(1,C) 5 k$ST++範-ST./usr/man/cat1/ksh.16. KSH(1,C) AIX Commands Reference KSH(1,C) ------------------------------------------------------------------------------ ksh, rksh PURPOSE KornShell, a standard/restricted command and programming language SYNTAX one of +-----+ +--------+ +-----------------+ +----------------+ | ksh |---| -i |---| one of one of |--| |----> | rksh| +--------+ | +---+ +-----+ | + -- -o Option --+ +-----+ +-| + |---| a n |-+ ^| - | | e t || |+---+ | f u || | | h v || | | k x || | +-----+| +---------------+ +------------------------------------+ | one of | >--| +-----------+ |---| | +--|-c String |--------------+ | +--| |-s | | | | +-----------+ |---+ | +---------------+ | +-- File -| |---+ +-- Parameter --+ DESCRIPTION Ksh is a command and programming language that executes commands read from a terminal or a file. Rksh is a restricted version of the command interpreter ksh ; it is used to set up login names and execution environments whose capabilities are more controlled than those of the standard shell. See Invocation below for the meaning of arguments to the shell. Definitions. A metacharacter is one of the following characters: ; & ( ) < > new-line space tab A blank is a tab or a space. An identifier is a sequence of letters, digits, or underscores starting with a letter or underscore. Identifiers are used as names for functions and variables . A word is a sequence of characters separated by one or more non-quoted metacharacters. A command is a sequence of characters in the syntax of the shell language. The shell reads each command and carries out the desired action either directly or by invoking separate utilities. A special command is a command that is carried out by the shell without creating a separate process. Except for documented side effects, most special commands can be implemented as separate utilities. Commands. A simple-command is a sequence of blank separated words which may be preceded by a variable assignment list. (See Environment below.) The first word specifies the name of the command to be executed. Except as specified below, the remaining words are passed as arguments to the invoked command. The command name is passed as argument 0 (see exec (2)). The value of a simple-command is its exit status if it terminates normally, or (octal) 200+status if it terminates abnormally (see signal (2) for a list of status values). A pipeline is a sequence of one or more commands separated by. The standard output of each command but the last is connected by a pipe (2) to the standard input of the next command. Each command is run as a separate process; the shell waits for the last command to terminate. The exit status of a pipeline is the exit status of the last command. A list is a sequence of one or more pipelines separated by ;, &, &&, or, and optionally terminated by ;, &, or &. Of these five symbols, ;, &, and & have equal precedence, which is lower than that of && and . The symbols && and also have equal precedence. A semicolon (;) causes sequential execution of the preceding pipeline; an ampersand (&) causes asynchronous execution of the preceding pipeline (i.e., the shell does not wait for that pipeline to finish). The symbol & causes asynchronous execution of the preceding command or pipeline with a two-way pipe established to the parent shell. The standard input and output of the spawned command can be written to and read from by the parent Shell using the -p option of the special commands read and print described later. The symbol && causes the list following it to be executed only if the preceding pipeline returns a zero (non-zero) value. An arbitrary number of new-lines may appear in a list, instead of a semicolon, to delimit a command. A command is either a simple-command or one of the following. Unless otherwise stated, the value returned by a command is that of the last simple-command executed in the command. for identifier [ in word . . . ] ;do list ;done Each time a for command is executed, identifier is set to the next word taken from the in word list. If in word . . . is omitted, then the for command executes the do list once for each positional parameter that is set (see Parameter Substitution below). Execution ends when there are no more words in the list. select identifier [ in word . . . ] ;do list ;done A select command prints on standard error (file descriptor 2), the set of word s, each preceded by a number. If in word . . . is omitted, then the positional parameters are used instead (see Parameter Substitution below). The PS3 prompt is printed and a line is read from the standard input. If this line consists of the number of one of the listed word s, then the value of the variable identifier is set to the word corresponding to this number. If this line is empty the selection list is printed again. Otherwise the value of the variable identifier is set to null . The contents of the line read from standard input is saved in the variable REPLY. The list is executed for each selection until a break or end-of-file is encountered. If the REPLY variable is set to null by the execution of list, then the selection list is printed before displaying the PS3 prompt for the next selection. case word in [ [ ( ]pattern [ pattern ] . . . ) list ;; ] . . . esac A case command executes the list associated with the first pattern that matches word. The form of the patterns is the same as that used for file-name generation (see File Name Generation below). if list ;then list [ elif list ;then list ] . . . [ ;else list ] ;fi The list following if is executed and, if it returns a zero exit status, the list following the first then is executed. Otherwise, the list following elif is executed and, if its value is zero, the list following the next then is executed. Failing that, the else list is executed. If no else list or then list is executed, then the if command returns a zero exit status. while list ;do list ;done until list ;do list ;done A while command repeatedly executes the while list and, if the exit status of the last command in the list is zero, executes the do list ; otherwise the loop terminates. If no commands in the do list are executed, then the while command returns a zero exit status; until may be used in place of while to negate the loop termination test. (list ) Execute list in a separate environment. Note, that if two adjacent open parentheses are needed for nesting, a space must be inserted to avoid arithmetic evaluation as described below. { list ;} list is simply executed. Note that unlike the metacharacters ( and ), { and } are reserved words and must occur at the beginning of a line or after a ; in order to be recognized. [[expression ]] Evaluates expression and returns a zero exit status when expression is true. See Conditional Expressions below, for a description of expression. function identifier { list ;} identifier () { list ;} Define a function which is referenced by identifier. The body of the function is the list of commands between { and }. (See Functions below). time pipeline The pipeline is executed and the elapsed time as well as the user and system time are printed on standard error. The following reserved words are only recognized as the first word of a command and when not quoted: if then else elif fi case esac for while until do done { } function select time [[ ]] Comments. A word beginning with # causes that word and all the following characters up to a new-line to be ignored. Aliasing. The first word of each command is replaced by the text of an alias if an alias for this word has been defined. An alias name consists of any number of characters excluding metacharacters, quoting characters, file expansion characters, parameter and command substitution characters, and =. The replacement string can contain any valid Shell script including the metacharacters listed above. The first word of each command in the replaced text, other than any that are in the process of being replaced, will be tested for aliases. If the last character of the alias value is a blank then the word following the alias will also be checked for alias substitution. Aliases can be used to redefine special builtin commands but cannot be used to redefine the reserved words listed above. Aliases can be created, listed, and exported with the alias command and can be removed with the unalias command. Exported aliases remain in effect for scripts invoked by name, but must be reinitialized for separate invocations of the Shell (see Invocation below). Aliasing is performed when scripts are read, not while they are executed. Therefore, for an alias to take effect the alias definition command has to be executed before the command which references the alias is read. Aliases are frequently used as a short hand for full path names. An option to the aliasing facility allows the value of the alias to be automatically set to the full pathname of the corresponding command. These aliases are called tracked aliases. The value of a tracked alias is defined the first time the corresponding command is looked up and becomes undefined each time the PATH variable is reset. These aliases remain tracked so that the next subsequent reference will redefine the value. Several tracked aliases are compiled into the shell. The -h option of the set command makes each referenced command name into a tracked alias. The following exported aliases are compiled into the shell but can be unset or redefined: autoload= typeset -fu false= let 0 functions= typeset -f hash= alias -t history= fc -l integer= typeset -i nohup= nohup r= fc -e - true= : type= whence -v Tilde Substitution. After alias substitution is performed, each word is checked to see if it begins with an unquoted. If it does, then the word up to a / is checked to see if it matches a user name in the /etc/passwd file. If a match is found, the and the matched login name are replaced by the login directory of the matched user. This is called a tilde substitution. If no match is found, the original text is left unchanged. A by itself, or in front of a /, is replaced by $HOME. A followed by a + or - is replaced by $PWD and $OLDPWD respectively. In addition, tilde substitution is attempted when the value of a variable assignment begins with a . Command Substitution. The standard output from a command enclosed in parenthesis preceded by a dollar sign ( $( ) ) or a pair of grave accents may be used as part or all of a word; trailing new-lines are removed. In the second (archaic) form, the string between the quotes is processed for special quoting characters before the ommand is executed. (See Quoting below.) The command substitution $( cat file ) can be replaced by the equivalent but faster $( ''. PS3 - Selection prompt string used within a select loop, by default ``#? ''. PS4 - The value of this variable is expanded for parameter substitution and precedes each line of an execution trace. If omitted, the execution trace prompt is ``+ ''. SHELL - The pathname of the shell is kept in the environment. At invocation, if the basename of this variable is rsh, rksh, or krsh, then the shell becomes restricted. TMOUT - If set to a value greater than zero, the shell will terminate if a command is not entered within the prescribed number of seconds after issuing the PS1 prompt. VISUAL - If the value of this variable ends in emacs, gmacs, or vi then the corresponding option (see Special Command set below) will be turned on. The shell gives default values to PATH, PS1, PS2, PS3, PS4, MAILCHECK, FCEDIT, TMOUT and IFS, while HOME, SHELL ENV and MAIL are not set at all by the shell (although HOME is set by login (1)). Blank Interpretation. After parameter and command substitution, the results of substitutions are scanned for the field separator characters (those found in IFS ) and split into distinct arguments where such characters are found. Explicit null arguments ( " " or ) are retained. Implicit null arguments (those resulting from parameters that have no values) are removed. File Name Generation. Following substitution, each command word is scanned for the characters, ?, and [ unless the -f option has been set. If one of these characters appears then the word is regarded as a pattern . The word is replaced with lexicographically sorted file names that match the pattern. If no file name is found that matches the pattern, then the word is left unchanged. When a pattern is used for file name generation, the character . at the start of a file name or immediately following a /, as well as the character / itself, must be matched explicitly. In other instances of pattern matching the / and . are not treated specially. * Matches any string, including the null string. ? Matches any single character. [...] Matches any one of the enclosed characters. A pair of characters separated by - matches any character lexically between the pair, inclusive. If the first character following the opening "[" is a "!" then any character not enclosed is matched. A - can be included in the character set by putting it as the first or last character. A pattern-list is a list of one or more patterns separated from each other with a *. Composite patterns can be formed with one or more of the following: ?(pattern-list ) Optionally matches any one of the given patterns. *(pattern-list ) Matches zero or more occurrences of the given patterns. +(pattern-list ) Matches one or more occurrences of the given patterns. @(pattern-list ) Matches exactly one of the given patterns. !(pattern-list ) Matches anything, except one of the given patterns. Quoting. Each of the metacharacters listed above (See Definitions above) has a special meaning to the shell and causes termination of a word unless quoted. A character may be quoted (i.e., made to stand for itself) by preceding it with a \. The pair \new-line is removed. All characters enclosed between a pair of single quote marks (' '), are quoted. A single quote cannot appear within single quotes. Inside double quote marks (" "), parameter and command substitution occur and \ quotes the characters \, , ", and $. The meaning of $ and $@ is identical when not quoted or when used as a parameter assignment value or as a file name. However, when used as a command argument, "$ " is equivalent to "$1d $2d . . .", where d is the first character of the IFS variable, whereas "$@" is equivalent to "$1" "$2" . . . . Inside grave quote marks (' ') \ quotes the characters \, , and $. If the grave quotes occur within double quotes then \ also quotes the character ". The special meaning of reserved words or aliases can be removed by quoting any character of the reserved word. The recognition of function names or special command names listed below cannot be altered by quoting them. Arithmetic Evaluation. An ability to perform integer arithmetic is provided with the special command let. Evaluations are performed using long arithmetic. Constants are of the form [ base# ]n where base is a decimal number between two and thirty-six representing the arithmetic base and n is a number in that base. If base is omitted then base 10 is used. An arithmetic expression uses the same syntax, precedence, and associativity of expression as the C language. All the integral operators, other than ++, - -, ?:, and, are supported. Variables can be referenced by name within an arithmetic expression without using the parameter substitution syntax. When a variable is referenced, its value is evaluated as an arithmetic expression. An internal integer representation of a variable can be specified with the -i option of the typeset special command. Arithmetic evaluation is performed on the value of each assignment to a variable with the -i attribute. If you do not specify an arithmetic base, the first assignment to the variable determines the arithmetic base. This base is used when parameter substitution occurs. Since many of the arithmetic operators require quoting, an alternative form of the let command is provided. For any command which begins with a ((, all the characters until a matching )) are treated as a quoted expression. More precisely, ((. . .)) is equivalent to let " . . .". Prompting. When used interactively, the shell prompts with the parameter expanded value of PS1 before reading a command. If at any time a new-line is typed and further input is needed to complete a command, then the secondary prompt (i.e., the value of PS2) is issued. Conditional Expressions. A conditional expression is used with the [[ compound command to test attribute s of files and to compare strings. Word splitting and file name generation are not performed on the words between [[ and ]]. Each expression can be constructed from one or more of the following unary or binary expressions: -a file True, if file exists. -b file True, if file exists and is a block special file. -c file True, if file exists and is a character special file. -d file True, if file exists and is a directory. -f file True, if file exists and is an ordinary file. -g file True, if file exists and is has its setgid bit set. -k file True, if file exists and is has its sticky bit set. -n string True, if length of string is non-zero. -o option True, if option named option is on. -p file True, if file exists and is a fifo special file or a pipe. -r file True, if file exists and is readable by current process. -s file True, if file exists and has size greater than zero. -t fildes True, if file descriptor number fildes is open and associated with a terminal device. -u file True, if file exists and is has its setuid bit set. -w file True, if file exists and is writable by current process. -x file True, if file exists and is executable by current process. If file exists and is a directory, then the current process has permission to search in the directory. -z string True, if length of string is zero. -L file True, if file exists and is a symbolic link. -O file True, if file exists and is owned by the effective user id of this process. -G file True, if file exists and its group matches the effective group id of this process. -S file True, if file exists and is a socket. file1 -nt file2 True, if file1 exists and is newer than file2 . file1 -ot file2 True, if file1 exists and is older than file2 . file1 -ef file2 True, if file1 and file2 exist and refer to the same file. string = pattern True, if string matches pattern . string != pattern True, if string does not match pattern . string1 < string2 True, if string1 comes before string2 based on ASCII value of their characters. string1 > string2 True, if string1 comes after string2 based on ASCII value of their characters. exp1 -eq exp2 True, if exp1 is equal to exp2 . exp1 -ne exp2 True, if exp1 is not equal to exp2 . exp1 -lt exp2 True, if exp1 is less than exp2 . exp1 -gt exp2 True, if exp1 is greater than exp2 . exp1 -le exp2 True, if exp1 is less than or equal to exp2 . exp1 -ge exp2 True, if exp1 is greater than or equal to exp2 . In each of the above expressions, if file is of the form /dev/fd/n, where n is an integer, then the test is applied to the open file whose descriptor number is n. A compound expression can be constructed from these primitives by using any of the following, listed in decreasing order of precedence. (expression) True, if expression is true. Used to group expressions. ! expression True if expression is false. expression1 && expression2 True, if expression1 and expression2 are both true. expression1 expression2 True, if either expression1 or expression2 is true. Input/Output. Before a command is executed, its input and output may be redirected using a special notation interpreted by the shell. The following may appear anywhere in a simple-command or may precede or follow a command and are not passed on to the invoked command. Command and parameter substitution occur before word or digit is used except as noted below. File name generation occurs only if the pattern matches a single file, and blank interpretation is not performed. word Use file word as standard output (file descriptor 1). If the file does not exist then it is created. If the file exists, and the noclobber option is on, this causes an error; otherwise, it is truncated to zero length. >|word Sames as >, except that it overrides the noclobber option. >>word Use file word as standard output. If the file exists then output is appended to it (by first seeking to the end-of-file); otherwise, the file is created. <>word Open file word for reading and writing as standard input. <<[-]word The shell input is read up to a line that is the same as word, or to an end-of-file. No parameter substitution, command substitution or file name generation is performed on word. The resulting document, called a here-document, becomes the standard input. If any character of word is quoted, then no interpretation is placed upon the characters of the document; otherwise, parameter and command substitution occur, \new-line is ignored, and \ must be used to quote the characters \, $, , and the first character of word . If - is appended to <<, then all leading tabs are stripped from word and from the document. <&digit The standard input is duplicated from file descriptor digit (see dup (2)). Similarly for the standard output using >& digit. <&- The standard input is closed. Similarly for the standard output using >&-. <&p The input from the co-process is moved to standard input. >&p The output to the co-process is moved to standard output. If one of the above is preceded by a digit, then the file descriptor number ref erred to is that specified by the digit (instead of the default 0 or 1). For example: . . . 2>&1 means file descriptor 2 is to be opened for writing as a duplicate of file descriptor 1. The order in which redirections are specified is significant. The shell evaluates each redirection in terms of the (file descriptor, file ) association at the time of evaluation. For example: . . . 1>fname 2>&1 first associates file descriptor 1 with file fname. It then associates file descriptor 2 with the file associated with file descriptor 1 (i.e. fname ). If the order of redirections were reversed, file descriptor 2 would be associated with the terminal (assuming file descriptor 1 had been) and then file descriptor 1 would be associated with file fname. If a command is followed by & and job control is not active, then the default standard input for the command is the empty file /dev/null. Otherwise, the environment for the execution of a command contains the file descriptors of the invoking shell as modified by input/output specifications. Environment. The environment (see environ (7)) is a list of name-value pairs that is passed to an executed program in the same way as a normal argument list. The names must be identifiers and the values are character strings. The shell interacts with the environment in several ways. On invocation, the shell scans the environment and creates a variable for each name found, giving it the corresponding value and marking it export . Executed commands inherit the environment. If the user modifies the values of these variables or creates new ones, using the export or typeset -x commands they become part of the environment. The environment seen by any executed command is thus composed of any name-value pairs originally inherited by the shell, whose values may be modified by the current shell, plus any additions which must be noted in export or typeset -x commands. The environment for any simple-command or function may be augmented by prefixing it with one or more variable assignments. A variable assignment argument is a word of the form identifier=value. Thus: TERM=450 cmd args and (export TERM; TERM=450; cmd args) are equivalent (as far as the above execution of cmd is concerned except for special commands listed below that are preceded with a dagger). If the -k flag is set, all variable assignment arguments are placed in the environment, even if they occur after the command name. The following first prints a=b c and then c: echo a=b c set -k echo a=b c This feature is intended for use with scripts written for early versions of the shell and its use in new scripts is strongly discouraged. It is likely to disappear someday. Functions. The function reserved word, described in the Commands section above, is used to define shell functions. Shell functions are read in and stored internally. Alias names are resolved when the function is read. Functions are executed like commands with the arguments passed as positional parameters. (See Execution below.) Functions execute in the same process as the caller and share all files and present working directory with the caller. Traps caught by the caller are reset to their default action inside the function. A trap condition that is not caught or ignored by the function causes the function to terminate and the condition to be passed on to the caller. A trap on EXIT set inside a function is executed after the function completes in the environment of the caller. Ordinarily, variables are shared between the calling program and the function. However, the typeset special command used within a function defines local variables whose scope includes the current function and all functions it calls. The special command return is used to return from function calls. Errors within functions return control to the caller. Function identifiers can be listed with the -f or +f option of the typeset special command. The text of functions will also be listed with -f. Functions can be undefined with the -f option of the unset special command. Ordinarily, functions are unset when the shell executes a shell script. The -xf option of the typeset command allows a function to be exported to scripts that are executed without a separate invocation of the shell. Functions that need to be defined across separate invocations of the shell should be specified in the ENV file with the -xf option of typeset. Jobs. If the monitor option of the set command is turned on, an interactive shell associates a job with each pipeline. It keeps a table of current jobs, printed by the jobs command, and assigns them small integer numbers. When a job is started asynchronously with &, the shell prints a line which looks like: [1] 1234 indicating that the job which was started asynchronously was job number 1 and had one (top-level) process, whose process id was 1234. If you are running a job and wish to do something else you may hit the key ^Z (control-Z) which sends a STOP signal to the current job. The shell will then normally indicate that the job has been `Stopped', and print another prompt. You can then manipulate the state of this job, putting it in the background with the bg command, or run some other commands and then eventually bring the job back into the foreground with the foreground command fg. A ^Z takes effect immediately and is like an interrupt in that pending output and unread input are discarded when it is typed. A job being run in the background will stop if it tries to read from the terminal. Background jobs are normally allowed to produce output, but this can be disabled by giving the command ``stty tostop''. If you set this tty option, then background jobs will stop when they try to produce output like they do when they try to read input. There are several ways to refer to jobs in the shell. A job can be referred to by the process id of any process of the job or by one of the following: %number - The job with the given number. %string - Any job whose command line begins with string . %?string - Any job whose command line contains string . %% - Current job. %+ - Equivalent to %%. %- - Previous job. The shell learns immediately whenever a process changes state. It normally informs you whenever a job becomes blocked so that no further progress is possible, but only just before it prints a prompt. This is done so that it does not otherwise disturb your work. When the monitor mode is on, each background job that completes triggers any trap set for CHLD. When you try to leave the shell while jobs are running or stopped, you will be warned that `You have stopped(running) jobs.' You may use the jobs command to see what they are. If you do this or immediately try to exit again, the shell will not warn you a second time, and the stopped jobs will be terminated. Signals. The INT and QUIT signals for an invoked command are ignored if the command is followed by & and the monitor option is not active. Otherwise, signals have the values inherited by the shell from its parent (but see also the trap special command below). Execution. Each time a command is executed, the above substitutions are carried out. If the command name matches one of the Special Commands listed below, it is executed within the current shell process. Next, the command name is checked to see if it matches one of the user defined functions. If it does, the positional parameters are saved and then reset to the arguments of the function call. When the function completes or issues a return, the positional parameter list is restored and any trap set on EXIT within the function is executed. The value of a function is the value of the last command executed. A function is also executed in the current shell process. If a command name is not a special command or a user defined function, a process is created and an attempt is made to execute the command via exec (2). The shell variable PATH defines the search path for the directory containing the command. Alternative directory names are separated by a colon (:). The default path is /bin:/usr/bin: (specifying /bin, /usr/bin, and the current directory in that order). The current directory can be specified by two or more adjacent colons, or by a colon at the beginning or end of the path list. If the command name contains a / then the search path is not used. Otherwise, each directory in the path is searched for an executable file. If the file has execute permission but is not a directory or an a.out file, it is assumed to be a file containing shell commands. A sub-shell is spawned to read it. All non-exported aliases, functions, and variables are removed in this case. If the shell command file doesn't have read permission, or if the setuid and/or setgid bits are set on the file, then the shell executes an agent whose job it is to set up the permissions and execute the shell with the shell command file passed down as an open file. A parenthesized command is executed in a sub-shell without removing non-exported quantities. Command Re-entry. The text of the last HISTSIZE (default 128) commands entered from a terminal device is saved in a history file. The file $HOME/.sh_history is used if the HISTFILE variable is not set or if the file it names is not writable. A shell can access the commands of all interactive shells which use the same named HISTFILE. The special command fc is used to list or edit a portion of this file. The portion of the file to be edited or listed can be selected by number or by giving the first character or characters of the command. A single command or range of commands can be specified. If you do not specify an editor program as an argument to fc then the value of the variable FCEDIT is used. If FCEDIT is not defined then /bin/ed is used. The edited command(s) is printed and re-executed upon leaving the editor. The editor name - is used to skip the editing phase and to re-execute the command. In this case a substitution parameter of the form old=new can be used to modify the command before execution. For example, if r is aliased to fc -e - then typing `r bad=good c' will re-execute the most recent command which starts with the letter c, replacing the first occurrence of the string bad with the string good. In-line Editing Options Normally, each command line entered from a terminal device is simply typed followed by a new-line (`RETURN' or `LINE FEED'). If either the emacs, gmacs, or vi option is active, the user can edit the command line. To be in either of these edit modes set the corresponding option. An editing option is automatically selected each time the VISUAL or EDITOR variable is assigned a value ending in either of these option names. The editing features require that the user's terminal accept `RETURN' as carriage return without line feed and that a space (` ') must overwrite the current character on the screen. ADM terminal users should set the "space - advance" switch to `space'. Hewlett-Packard series 2621 terminal users should set the straps to `bcGHxZ etX'. The editing modes implement a concept where the user is looking through a window at the current line. The window width is the value of COLUMNS if it is defined, otherwise 80. If the line is longer than the window width minus two, a mark is displayed at the end of the window to notify the user. As the cursor moves and reaches the window boundaries the window will be centered about the cursor. The mark is a > (<, *) if the line extends on the right (left, both) side(s) of the window. The search commands in each edit mode provide access to the history file. Only strings are matched, not patterns, although a leading ^ in the string restricts the match to begin at the first character in the line. Emacs Editing Mode This mode is entered by enabling either the emacs or gmacs option. The only difference between these two modes is the way they handle ^T. To edit, the user moves the cursor to the point needing correction and then inserts or deletes characters or words as needed. All the editing commands are control characters or escape sequences. The notation for control characters is caret ( ^ ) followed by the character. For example, ^F is the notation for control F. This is entered by depressing `f' while holding down the `CTRL' (control) key. The `SHIFT' key is not depressed. (The notation ^? indicates the DEL (delete) key.) The notation for escape sequences is M- followed by a character. For example, M -f (pro-nounced Meta f) is entered by depressing ESC (ascii 033) followed by `f'. (M-F would be the notation for ESC followed by `SHIFT' (capital) `F'.) All edit commands operate from any place on the line (not just at the beginning). Neither the "RETURN" nor the "LINE FEED" key is entered after edit commands except when noted. ^F Move cursor forward (right) one character. M-f Move cursor forward one word. (The emacs editor's idea of a word is a string of characters consisting of only letters, digits and underscores.) ^B Move cursor backward (left) one character. M-b Move cursor backward one word. ^A Move cursor to start of line. ^E Move cursor to end of line. ^]char Move cursor forward to character char on current line. M-^]char Move cursor backward to character char on current line. ^X^X Interchange the cursor and mark. erase (User defined erase character as defined by the stty (1) command, usually ^H or #.) Delete previous character. ^D Delete current character. M-d Delete current word. M-^H (Meta-backspace) Delete previous word. M-h Delete previous word. M-^? (Meta-DEL) Delete previous word (if your interrupt character is ^? (DEL, the default) then this command will not work). ^T Transpose current character with next character in emacs mode. Transpose two previous characters in gmacs mode. ^C Capitalize current character. M-c Capitalize current word. M-l Change the current word to lower case. ^K Delete from the cursor to the end of the line. If preceded by a numerical parameter whose value is less than the current cursor position, then delete from given position up to the cursor. If preceded by a numerical parameter whose value is greater than the current cursor position, then delete from cursor up to given cursor position. ^W Kill from the cursor to the mark. M-p Push the region from the cursor to the mark on the stack. kill (User defined kill character as defined by the stty command, usually ^G or @.) Kill the entire current line. If two kill characters are entered in succession, all kill characters from then on cause a line feed (useful when using paper terminals). ^Y Restore last item removed from line. (Yank item back to the line.) ^L Line feed and print current line. ^@ (Null character) Set mark. M-space (Meta space) Set mark. ^J (New line) Execute the current line. ^M (Return) Execute the current line. eof End-of-file character, normally ^D, is processed as an End-of-file only if the current line is null. ^P Fetch previous command. Each time ^P is entered the previous command back in time is accessed. Moves back one line when not on the first line of a multi-line command. M-< Fetch the least recent (oldest) history line. M-> Fetch the most recent (youngest) history line. ^N Fetch next command line. Each time ^N is entered the next command line forward in time is accessed. ^Rstring Reverse search history for a previous command line containing string. If a parameter of zero is given, the search is forward. String is terminated by a "RETURN" or "NEW LINE". If string is preceded by a ^, the matched line must begin with string. If string is omitted, then the next command line containing the most recent string is accessed. In this case a parameter of zero reverses the direction of the search. ^O Operate Execute the current line and fetch the next line relative to current line from the history file. M-digits (Escape) Define numeric parameter, the digits are taken as a parameter to the next command. The commands that accept a parameter are ^F, ^B, erase, ^C, ^D, ^K, ^R, ^P, ^N, ^], M-., M-^], M-_, M-b, M-c, M-d, M-f, M-h, M-l and M-^H. M-letter Soft-key Your alias list is searched for an alias by the name _letter and if an alias of this name is defined, its value will be inserted on the input queue. The letter must not be one of the above meta-functions. M-[letter Soft-key Your alias list is searched for an alias by the name __letter and if an alias of this name is defined, its value will be inserted on the input queue. The can be used to program functions keys on many terminals. M-. The last word of the previous command is inserted on the line. If preceded by a numeric parameter, the value of this parameter determines which word to insert rather than the last word. M-_ Same as M-.. M-* Attempt file name generation on the current word. An asterisk is appended if the word doesn't match any file or contain any special pattern characters. M-ESC File name completion. Replaces the current word with the longest common prefix of all filenames matching the current word with an asterisk appended. If the match is unique, a / is appended if the file is a directory and a space is appended if the file is not a directory. M-= List files matching current word pattern if an asterisk were appended. ^U Multiply parameter of next command by 4. \ Escape next character. Editing characters, the user's erase, kill and interrupt (normally ^?) characters may be entered in a command line or in a search string if preceded by a \. The \ removes the next character's editing features (if any). ^V Display version of the shell. M-# Insert a # at the beginning of the line and execute it. This causes a comment to be inserted in the history file. Vi Editing Mode There are two typing modes. Initially, when you enter a command you are in the input mode. To edit, the user enters control mode by typing ESC (033) and moves the cursor to the point needing correction and then inserts or deletes characters or words as needed. Most control commands accept an optional repeat count prior to the command. When in vi mode on most systems, canonical processing is initially enabled and the command will be echoed again if the speed is 1200 baud or greater and it contains any control characters or less than one second has elapsed since the prompt was printed. The ESC character terminates canonical processing for the remainder of the command and the user can then modify the command line. This scheme has the advantages of canonical processing with the type-ahead echoing of raw mode. If the option viraw is also set, the terminal will always have canonical processing disabled. This mode is implicit for systems that do not support two alternate end of line delimiters, and may be helpful for certain terminals. Input Edit Commands By default the editor is in input mode. erase (User defined erase character as defined by the stty command, usually ^H or #.) Delete previous character. ^W Delete the previous blank separated word. ^D Terminate the shell. ^V Escape next character. Editing characters and the user's erase or kill characters may be entered in a command line or in a search string if preceded by a ^V. The ^V removes the next character's editing features (if any). \ Escape the next erase or kill character. Motion Edit Commands These commands will move the cursor. [count]l Cursor forward (right) one character. [count]w Cursor forward one alpha-numeric word. [count]W Cursor to the beginning of the next word that follows a blank. [count]e Cursor to end of word. [count]E Cursor to end of the current blank delimited word. [count]h Cursor backward (left) one character. [count]b Cursor backward one word. [count]B Cursor to preceding blank separated word. [count] Cursor to column count . [count]fc Find the next character c in the current line. [count]Fc Find the previous character c in the current line. [count]tc Equivalent to f followed by h. [count]Tc Equivalent to F followed by l. [count]; Repeats count times, the last single character find command, f, F, t, or T. [count], Reverses the last single character find command count times. 0 Cursor to start of line. ^ Cursor to first non-blank character in line. $ Cursor to end of line. % Moves to balancing (, ), {, }, [, or ]. If cursor is not on one of the above characters, the remainder of the line is searched for the first occurrence of one of the above characters first. Search Edit Commands These commands access your command history. [count]k Fetch previous command. Each time k is entered the previous command back in time is accessed. [count] Equivalent to k. [count]j Fetch next command. Each time j is entered the next command forward in time is accessed. [count]+ Equivalent to j. [count]G The command number count is fetched. The default is the least recent history command. /string Search backward through history for a previous command containing string. String is terminated by a "RETURN" or "NEW LINE". If string is preceded by a ^, the matched line must begin with string . If string is null the previous string will be used. ?string Same as / except that search will be in the forward direction. n Search for next match of the last pattern to / or ? commands. N Search for next match of the last pattern to / or ?, but in reverse direction. Search history for the string entered by the previous / command. Text Modification Edit Commands These commands will modify the line. a Enter input mode and enter text after the current character. A Append text to the end of the line. Equivalent to $a. c[count]cmotion c[count]motion Delete current character through the character that motion would move the cursor to and enter input mode. If motion is c, the entire line will be deleted and input mode entered. C Delete the current character through the end of line and enter input mode. Equivalent to c$. S Equivalent to cc. D Delete the current character through the end of line. Equivalent to d$. [count]dmotion d[count]motion Delete current character through the character that motion would move to. If motion is d, the entire line will be deleted. i Enter input mode and insert text before the current character. I Insert text before the beginning of the line. Equivalent to 0i. [count]P Place the previous text modification before the cursor. [count]p Place the previous text modification after the cursor. R Enter input mode and replace characters on the screen with characters you type overlay fashion. [count]rc Replace the count character(s) starting at the current cursor position with c, and advance the cursor. [count]x Delete current character. [count]X Delete preceding character. [count]. Repeat the previous text modification command. [count] Invert the case of the count character(s) starting at the current cursor position and advance the cursor. [count]_ Causes the count word of the previous command to be appended and input mode entered. The last word is used if count is omitted. * Causes an * to be appended to the current word and file name generation attempted. If no match is found, it rings the bell. Otherwise, the word is replaced by the matching pattern and input mode is entered. \ Filename completion. Replaces the current word with the longest common prefix of all filenames matching the current word with an asterisk appended. If the match is unique, a / is appended if the file is a directory and a space is appended if the file is not a directory. Other Edit Commands Miscellaneous commands. [count]ymotion y[count]motion Yank current character through character that motion would move the cursor to and puts them into the delete buffer. The text and cursor are unchanged. Y Yanks from current position to end of line. Equivalent to y$. u Undo the last text modifying command. U Undo all the text modifying commands performed on the line. [count]v Returns the command fc -e ${VISUAL:-${EDITOR:-vi}} count in the input buffer. If count is omitted, then the current line is used. ^L Line feed and print current line. Has effect only in control mode. ^J (New line) Execute the current line, regardless of mode. ^M (Return) Execute the current line, regardless of mode. # If the first character of the command is a #, then this command deletes this # and each # that follows a newline. Otherwise, sends the line after inserting a # in front of each line in the command. Useful for causing the current line to be inserted in the history as a comment and removing comments from previous comment commands in the history file. = List the file names that match the current word if an asterisk were appended it. @letter Your alias list is searched for an alias by the name _letter and if an alias of this name is defined, its value will be inserted on the input queue for processing. Special Commands. The following simple-commands are executed in the shell process. Input/Output redirection is permitted. Unless otherwise indicated, the output is written on file descriptor 1 and the exit status, when there is no syntax error, is zero. Commands that are preceded by one or two are treated specially in the following ways: 1. Variable assignment lists preceding the command remain in effect when the command completes. 2. I/O redirections are processed after variable assignments. 3. Errors cause a script that contains them to abort. 4. Words, following a command preceded by that are in the format of a variable assignment, are expanded with the same rules as a variable assignment. This means that tilde substitution is performed after the = sign and word splitting and file name generation are not performed. : [ arg . . . ] The command only expands parameters. . file [ arg . . . ] Read the complete file then execute the commands. The commands are executed in the current Shell environment. The search path specified by PATH is used to find the directory containing file. If any arguments arg are given, they become the positional parameters. Otherwise the positional parameters are unchanged. The exit status is the exit status of the last command executed. alias [ -tx ] [ name[ =value ] ] . . . alias with no arguments prints the list of aliases in the form name=value on standard output. An alias is defined for each name whose value is given. A trailing space in value causes the next word to be checked for alias substitution. The -t flag is used to set and list tracked aliases. The value of a tracked alias is the full pathname corresponding to the given name. The value becomes undefined when the value of PATH is reset but the aliases remained tracked. Without the -t flag, for each name in the argument list for which no value is given, the name and value of the alias is printed. The -x flag is used to set or print exported aliases. An exported alias is defined for scripts invoked by name. The exit status is non-zero if a name is given, but no value, and no alias has been defined for the name. bg [ job . . . ] This command is only on systems that support job control. Puts each specified job into the background. The current job is put in the background if job is not specified. See Jobs for a description of the format of job . break [ n ] Exit from the enclosing for, while, until, or select loop, if any. If n is specified then break n levels. continue [ n ] Resume the next iteration of the enclosing for, while, until, or select loop. If n is specified then resume at the n -th enclosing loop. cd [ arg ] cd old new This command can be in either of two forms. In the first form it changes the current directory to arg . If arg is - the directory is changed to the previous directory. The shell variable HOME is the default arg. The variable PWD is set to the current directory. The shell variable CDPATH defines the search path for the directory containing arg . Alternative directory names are separated by a colon (:). The default path is (specifying the current directory). Note that the current directory is specified by a null path name, which can appear immediately after the equal sign or between the colon delimiters anywhere else in the path list. If arg begins with a / then the search path is not used. Otherwise, each directory in the path is searched for arg. The second form of cd substitutes the string new for the string old in the current directory name, PWD and tries to change to this new directory. The cd command may not be executed by rksh. echo [ arg . . . ] See echo (1) for usage and description. eval [ arg . . . ] The arguments are read as input to the shell and the resulting command(s) executed. exec [ arg . . . ] If arg is given, the command specified by the arguments is executed in place of this shell without creating a new process. Input/output arguments may appear and affect the current process. If no arguments are given the effect of this command is to modify file descriptors as prescribed by the input/output redirection list. In this case, any file descriptor numbers greater than 2 that are opened with this mechanism are closed when invoking another program. exit [ n ] Causes the shell to exit with the exit status specified by n. The value will be the least significant 8 bits of the specified status. If n is omitted then the exit status is that of the last command executed. An end-of-file will also cause the shell to exit except for a shell which has the ignoreeof option (See set below) turned on. export [ name[ =value ] ] . . . The given name s are marked for automatic export to the environment of subsequently executed commands. fc [ -e ename ] [ -nlr ] [ first [ last ] ] fc -e - [ old=new ] [ command ] In the first form, a range of commands from first to last is selected from the last HISTSIZE commands that were typed at the terminal. The arguments first and last may be specified as a number or as a string. A string is used to locate the most recent command starting with the given string. A negative number is used as an offset to the current command number. If the -l flag is selected, the commands are listed on standard output. Otherwise, the editor program ename is invoked on a file containing these keyboard commands. If ename is not supplied, then the value of the variable FCEDIT (default /bin/ed ) is used as the editor. When editing is complete, the edited command(s) is executed. If last is not specified then it will be set to first. If first is not specified the default is the previous command for editing and -16 for listing. The flag -r reverses the order of the commands and the flag -n suppresses command numbers when listing. In the second form the command is re-executed after the substitution old=new is performed. fg [ job . . . ] This command is only on systems that support job control. Each job specified is brought to the foreground. Otherwise, the current job is brought into the foreground. See Jobs for a description of the format of job. getopts optstring name [ arg . . . ] Checks arg for legal options. If arg is omitted, the positional parameters are used. An option argument begins with a + or a -. An option not beginning with + or - or the argument - - ends the options. optstring contains the letters that getopts recognizes. If a letter is followed by a :, that option is expected to have an argument. The options can be separated from the argument by blanks. getopts places the next option letter it finds inside variable name each time it is invoked with a + prepended when arg begins with a +. The index of the next arg is stored in OPTIND. The option argument, if any, gets stored in OPTARG. A leading : in optstring causes getopts to store the letter of an invalid option in OPTARG, and to set name to ? for an unknown option and to : when a required option is missing. Otherwise, getopts prints an error message. The exit status is non-zero when there are no more options. jobs [ -lnp ] [ job . . . ] Lists information about each given job; or all active jobs if job is omitted. The -l flag lists process ids in addition to the normal information. The -n flag only displays jobs that have stopped or exited since last notified. The -p flag causes only the process group to be listed. See Jobs for a description of the format of job. kill [ -sig ] job . . . kill -l Sends either the TERM (terminate) signal or the specified signal to the specified jobs or processes. Signals are either given by number or by names (as given in , stripped of the prefix ``SIG'' with the exception that SIGCHD is named CHLD). If the signal being sent is TERM (terminate) or HUP (hangup), then the job or process will be sent a CONT (continue) signal if it is stopped. The argument job can be the process id of a process that is not a member of one of the active jobs. See Jobs for a description of the format of job. In the second form, kill -l, the signal numbers and names are listed. let arg . . . Each arg is a separate arithmetic expression to be evaluated. See Arithmetic Evaluation above, for a description of arithmetic expression evaluation. The exit status is 0 if the value of the last expression is non-zero, and 1 otherwise. newgrp [ arg . . . ] Equivalent to exec /bin/newgrp arg . . . . print [ -Rnprsu [ n ] ] [ arg . . . ] The shell output mechanism. With no flags or with flag - or - -, the arguments are printed on standard output as described by echo (1). In raw mode, -R or -r, the escape conventions of echo are ignored. The -R option will print all subsequent arguments and options other than -n. The -p option causes the arguments to be written onto the pipe of the process spawned with & instead of standard output. The -s option causes the arguments to be written onto the history file instead of standard output. The -u flag can be used to specify a one digit file descriptor unit number n on which the output will be placed. The default is 1. If the flag -n is used, no new-line is added to the output. pwd Equivalent to print -r - $PWD read [ -prsu [ n ] ] [ name?prompt ] [ name . . . ] The shell input mechanism. One line is read and is broken up into fields using the characters in IFS as separators. The escape character, \, is used to remove any special meaning for the next character and for line continuation. In raw mode, -r, the \ character is not treated specially. The first field is assigned to the first name, the second field to the second name, etc., with leftover fields assigned to the last name. The -p option causes the input line to be taken from the input pipe of a process spawned by the shell using &. If the -s flag is present, the input will be saved as a command in the history file. The flag -u can be used to specify a one digit file descriptor unit n to read from. The file descriptor can be opened with the exec special command. The default value of n is 0. If name is omitted then REPLY is used as the default name. The exit status is 0 unless an end-of-file is encountered. An end-of-file with the -p option causes cleanup for this process so that another can be spawned. If the first argument contains a ?, the remainder of this word is used as a prompt on standard error when the shell is interactive. The exit status is 0 unless an end-of-file is encountered. readonly [ name[ =value ] ] . . . The given name s are marked readonly and these names cannot be changed by subsequent assignment. return [ n ] Causes a shell function or . script to return to the invoking script with the return status specified by n . The value will be the least significant 8 bits of the specified status. If n is omitted then the return status is that of the last command executed. If return is invoked while not in a function or a . script, then it is the same as an exit. set [ aefhkmnopstuvx ] [ o option ]. . . [ A name ] [ arg . . . ] The flags for this command have meaning as follows: -A Array assignment. Unset the variable name and assign values sequentially from the list arg. If +A is used, the variable name is not unset first. -a All subsequent variables that are defined are automatically exported. -e If a command has a non-zero exit status, execute the ERR trap, if set, and exit. This mode is disabled while reading profiles. -f Disables file name generation. -h Each command becomes a tracked alias when first encountered. -k All variable assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Background jobs will run in a separate process group and a line will print upon completion. The exit status of background jobs is reported in a completion message. On systems with job control, this flag is turned on automatically for interactive shells. -n Read commands and check them for syntax errors, but do not execute them. Ignored for interactive shells. -o The following argument can be one of the following option names: allexport - Same as -a. errexit - Same as -e. bgnice - All background jobs are run at a lower priority. This is the default mode. emacs - Puts you in an emacs style in-line editor for command entry. gmacs - Puts you in a gmacs style in-line editor for command entry. ignoreeof - The shell will not exit on end-of-file. The command exit must be used. keyword - Same as -k. markdirs - All directory names resulting from file name generation have a trailing / appended. monitor - Same as -m. noclobber - Prevents redirection > from truncating existing files. Require > to truncate a file when turned on. noexec - Same as -n. noglob - Same as -f. nolog - Do not save function definitions in history file. nounset - Same as -u. privileged- Same as -p. verbose - Same as -v. trackall - Same as -h. vi - Puts you in insert mode of a vi style in-line editor until you hit escape character 033. This puts you in control mode. A return sends the line. viraw - Each character is processed as it is typed in vi mode. xtrace - Same as -x. If no option name is supplied then the current option settings are printed. -p Disables processing of the $HOME/.profile file and uses the file /etc/suid_profile instead of the ENV file. This mode is on whenever the effective uid (gid) is not equal to the real uid (gid). Turning this off causes the effective uid and gid to be set to the real uid and gid. -s Sort the positional parameters lexicographically. -t Exit after reading and executing one command. -u Treat unset parameters as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. - Turns off -x and -v flags and stops examining arguments for flags. - - Do not change any of the flags; useful in setting $1 to a value beginning with -. If no arguments follow this flag then the positional parameters are unset. Using + rather than - causes these flags to be turned off. These flags can also be used upon invocation of the shell. The current set of flags may be found in $-. Unless -A is specified, the remaining arguments are positional parameters and are assigned, in order, to $1 $2 . . . . If no arguments are given then the names and values of all variables are printed on the standard output. shift [ n ] The positional parameters from $n+1 . . . are renamed $1 . . . , default n is 1. The parameter n can be any arithmetic expression that evaluates to a non-negative number less than or equal to $#. times Print the accumulated user and system times for the shell and for processes run from the shell. trap [ arg ] [ sig ] . . . arg is a command to be read and executed when the shell receives signal(s) sig. (Note that arg is scanned once when the trap is set and once when the trap is taken.) Each sig can be given as a number or as the name of the signal. Trap commands are executed in order of signal number. Any attempt to set a trap on a signal that was ignored on entry to the current shell is ineffective. If arg is omitted or is -, then the trap(s) for each sig are reset to their original values. If arg is the null string then this signal is ignored by the shell and by the commands it invokes. If sig is ERR then arg will be executed whenever a command has a non-zero exit status. If sig is DEBUG then a rg will be executed after each command. If sig is 0 or EXIT and the trap statement is executed inside the body of a function, then the command arg is executed after the function completes. If sig is 0 or EXIT for a trap set outside any function then the command arg is executed on exit from the shell. The trap command with no arguments prints a list of commands associated with each signal number. typeset [ HLRZfilrtux [ n ] ] [ name[ =value ] ] . . . Sets attributes and values for shell variables and functions. When invoked inside a function, a new instance of the variables name is created. The variables value and type are restored when the function completes. The following list of attributes may be specified: -H This flag provides UNIX to host-name file mapping on non-UNIX machines. -L Left justify and remove leading blanks from value. If n is non-zero it defines the width of the field, otherwise it is determined by the width of the value of first assignment. When the variable is assigned to, it is filled on the right with blanks or truncated, if necessary, to fit into the field. Leading zeros are removed if the -Z flag is also set. The -R flag is turned off. -R Right justify and fill with leading blanks. If n is non-zero it defines the width of the field, otherwise it is determined by the width of the value of first assignment. The field is left filled with blanks or truncated from the end if the variable is reassigned. The -L flag is turned off. -Z Right justify and fill with leading zeros if the first non-blank character is a digit and the -L flag has not been set. If n is non-zero it defines the width of the field, otherwise it is determined by the width of the value of first assignment. -f The names refer to function names rather than variable names. No assignments can be made and the only other valid flags are -t, -u and -x. The flag -t turns on execution tracing for this function. The flag -u causes this function to be marked undefined. The FPATH variable will be searched to find the function definition when the function is referenced. The flag -x allows the function definition to remain in effect across shell procedures invoked by name. -i Parameter is an integer. This makes arithmetic faster. If n is non-zero it defines the output arithmetic base, otherwise the first assignment determines the output base. -l All upper-case characters are converted to lower-case. The upper-case flag, -u is turned off. -r The given name s are marked readonly and these names cannot be changed by subsequent assignment. -t Tags the variables. Tags are user definable and have no special meaning to the shell. -u All lower-case characters are converted to upper-case characters. The lower-case flag, -l is turned off. -x The given name s are marked for automatic export to the environment of subsequently-executed commands. The -i attribute can not be specified along with -R, -L, -Z, or -f. Using + rather than - causes these flags to be turned off. If no name arguments are given but flags are specified, a list of names (and optionally the values ) of the variables which have these flags set is printed. (Using + rather than - keeps the values from being printed.) If no name s and flags are given, the names and attributes of all variables are printed. ulimit [ -HSacdfmnpstv ] [ limit ] Set or display a resource limit. The available resources limits are listed below. Many systems do not contain one or more of these limits. The limit for a specified resource is set when limit is specified. The value of limit can be a number in the unit specified below with each resource, or the value unlimited. The H and S flags specify whether the hard limit or the soft limit for the given resource is set. A hard limit cannot be increased once it is set. A soft limit can be increased up to the value of the hard limit. If neither the H or S options is specified, the limit applies to both. The current resource limit is printed when limit is omitted. In this case the soft limit is printed unless H is specified. When more that one resource is specified, then the limit name and unit is printed before the value. -a Lists all of the current resource limits. -c The number of 512-byte blocks on the size of core dumps. -d The number of K-bytes on the size of the data area. -f The number of 512-byte blocks on files written by child processes (files of any size may be read). -m The number of K-bytes on the size of physical memory. -n The number of file descriptors plus 1. -p The number of 512-byte blocks for pipe buffering. -s The number of K-bytes on the size of the stack area. -t The number of seconds to be used by each process. -v The number of K-bytes for virtual memory. If no option is given, -f is assumed. umask [ mask ] The user file-creation mask is set to mask (see umask (2)). mask can either be an octal number or a symbolic value as described in chmod (1). If a symbolic value is given, the new umask value is the complement of the result of applying mask to the complement of the previous umask value. If mask is omitted, the current value of the mask is printed. unalias name . . . The aliases given by the list of name s are removed from the alias list. unset [ -f ] name . . . The variables given by the list of name s are unassigned, i.e., their values and attributes are erased. Readonly variables cannot be unset. If the -f, flag is set, then the names refer to function names. Unsetting ERRNO, LINENO, MAILCHECK, OPTARG, OPTIND, RANDOM, SECONDS, TMOUT, and _ removes their special meaning even if they are subsequently assigned to. wait [ job ] Wait for the specified job and report its termination status. If job is not given then all currently active child processes are waited for. The exit status from this command is that of the process waited for. See Jobs for a description of the format of job. whence [ -pv ] name . . . For each name, indicate how it would be interpreted if used as a command name. The -v flag produces a more verbose report. The -p flag does a path search for name even if name is an alias, a function, or a reserved word. Invocation. If the shell is invoked by exec (2), and the first character of argument zero ($0) is -, then the shell is assumed to be a login shell and commands are read from /etc/profile and then from either .profile in the current directory or $HOME/.profile, if either file exists. Next, commands are read from the file named by performing parameter substitution on the value of the environment variable ENV if the file exists. If the -s flag is not present and arg is, then a path search is performed on the first arg to determine the name of the script to execute. The script arg must have read permission and any setuid and getgid settings will be ignored. If the script is not found on the path, arg is processed as if it named a builtin command or function. Commands are then read as described below; the following flags are interpreted by the shell when it is invoked: -c string If the -c flag is present then commands are read from string. -s If the -s flag is present or if no arguments remain then commands are read from the standard input. Shell output, except for the output of the Special Commands listed above, is written to file descriptor 2. -i If the -i flag is present or if the shell input and output are attached to a terminal (as told by ioctl (2)) then this shell is interactive . In this case TERM is ignored (so that kill 0 does not kill an interactive shell) and INTR is caught and ignored (so that wait is interruptible). In all cases, QUIT is ignored by the shell. -r If the -r flag is present the shell is a restricted shell. The remaining flags and arguments are described under the set command above. Rksh Only. Rksh is used to set up login names and execution environments whose capabilities are more controlled than those of the standard shell. The actions of rksh are identical to those of ksh, except that the following are disallowed: - changing directory (see cd (1)), - setting the value of SHELL, ENV, or PATH, - specifying path or command names containing /, - redirecting output (>, >|, <>, and >>). The restrictions above are enforced after .profile and the ENV files are interpreted. When a command to be executed is found to be a shell procedure, rksh invokes ksh to execute it. Thus, it is possible to provide to the end-user shell procedures that have access to the full power of the standard shell, while imposing a limited menu of commands; this scheme assumes that the end-user does not have write and execute permissions in the same directory. The net effect of these rules is that the writer of the .profile has complete control over user actions, by performing guaranteed setup actions and leaving the user in an appropriate directory (probably not the login directory). The system administrator often sets up a directory of commands (i.e., /usr/rbin) that can be safely invoked by rksh . EXIT STATUS Errors detected by the shell, such as syntax errors, cause the shell to return a non-zero exit status. Otherwise, the shell returns the exit status of the last command executed (see also the exit command above). If the shell is being used non-interactively then execution of the shell file is abandoned. Run time errors detected by the shell are reported by printing the command or function name and the error condition. If the line number that the error occurred on is greater than one, then the line number is also printed in square brackets ([]) after the command or function name. FILES /etc/passwd /etc/profile /etc/suid_profile $HOME/.profile /tmp/sh /dev/null SEE ALSO cat(1), cd(1), chmod(1), cut(1), echo(1), emacs(1), env(1), gmacs(1), newgrp(1), stty(1), test(1), umask(1), vi(1), dup(2), exec(2), fork(2), ioctl(2), lseek(2), paste(1), pipe(2), signal(2), umask(2), ulimit(2), wait(2), rand(3), a.out(5), profile(5), environ(7). Morris I. Bolsky and David G. Korn, The KornShell Command and Programming Language, Prentice Hall, 1989. CAVEATS If a command which is a tracked alias is executed, and then a command with the same name is installed in a directory in the search path before the directory where the original command was found, the shell will continue to exec the original command. Use the -t option of the alias command to correct this situation. Some very old shell scripts contain a ^ as a synonym for the pipe character. Using the fc built-in command within a compound command will cause the whole command to disappear from the history file. The built-in command .file reads the whole file before any commands are executed. Therefore, alias and unalias commands in the file will not apply to any functions defined in the file. Traps are not processed while a job is waiting for a foreground process. Thus, a trap on CHLD won't be executed until the foreground job terminates. ead k꼊$~#A++範-~#./usr/man/cat1/more.16. MORE, PAGE(1,C) AIX Commands Reference MORE, PAGE(1,C) ------------------------------------------------------------------------------- more, page PURPOSE Acts as the perusal filter for screen viewing. SYNTAX one of +------+ +-----------------+ | more |---| +-------------+ |--- filename ---| | page | +-| -c -n |-+ ^ | +------+ ^| -d -p || +------------+ || -f -s || || -l -u || || +linenumber || || +/pattern || |+-------------+| +---------------+ DESCRIPTION The more command is a filter that allows examination of a continuous text, one screen at a time. The program normally pauses after each screen and displays the word "more" at the bottom of the screen. If the user then types a carriage return, one more line is displayed. Pressing the space bar displays another screen of information. If the program is invoked as page, the screen is cleared before each screen is printed (but only if a full screen is being printed), and k-1 rather than k-2 lines are printed in each screen, where k is the number of lines the terminal can display. The more command looks in the file /etc/termcap to determine terminal characteristics and to determine the default window size. On a terminal capable of displaying 24 lines, the default window size is 22 lines. The more command looks in the environment variable MORE to pre-set any flags desired. For example, if you prefer to view files using the -c mode of operation, the csh command setenv more -c or the sh command sequence more='-c'; export more causes all invocations of the more command including invocations by such programs as man to use this mode. Normally, the user places the command sequence which sets up the MORE environment variable in the cshrc or .profile file. Processed November 8, 1990 MORE, PAGE(1,C) 1 MORE, PAGE(1,C) AIX Commands Reference MORE, PAGE(1,C) If the more command is reading from a file, rather than a pipe, a percentage is displayed along with the "--More" prompt. This gives the fraction of the file (in characters, not lines) that has been read so far. FLAGS -n Determines the size (in lines) of the window, where -n is an integer. -c Draws each page by beginning at the top of the screen by erasing each line just before the more command draws on it. This avoids scrolling the screen and makes it easier to read while the command is writing. This option is ignored if the terminal does not have the ability to clear to the end of a line. -d Prints messages for novice users. -f Causes more to count logical lines rather than screen lines. That is, long lines are not folded. This option is useful if nroff output is being piped through ul since ul may generate escape sequences. These escape sequences contain characters which would ordinarily occupy screen positions but do not print. Thus, more may think that lines are longer than they actually are and fold line erroneously. -l Ignores a form feed (ctrl-L); that is, more does not pause after any line that contains a Ctrl-L and does not clear the screen if a file begins with a Ctrl-L. -p Clear the screen before displaying a new screen. -s Removes multiple blank lines from the output, producing only one blank line. This options is useful when viewing nroff output, maximizing the amount of useful information that can be viewed on the screen. -u Normally, more handles underlining produced by nroff in a manner appropriate to the particular terminal. If the terminal can perform underlining or has a stand-out mode, more outputs the appropriate escape sequences to enable underlining or stand-out mode for underlined information in the source file. The -u option suppresses this processing. +linenumber Starts up at linenumber. +/pattern Starts up two lines before the line containing the regular expression pattern. Other sequences which may be typed when More pauses, and their effects, follow (i is an optional integer argument, defaulting to 1 (the numeral 1)): Processed November 8, 1990 MORE, PAGE(1,C) 2 MORE, PAGE(1,C) AIX Commands Reference MORE, PAGE(1,C) i Displays i more lines (or another screen if no argument is given). If stty speed is set to less than 1200 baud, you must follow i with a (carriage return). Ctrl-B Scrolls backward one screen. b Scrolls backward one screen. Same as Ctrl-B. Ctrl-D Displays 11 more lines (a "scroll"). If i is given, the scroll size is set to i. d Same as Ctrl-D. i z Same as typing a space except that i, if present, becomes the new window size. i s Skips i lines and prints a screenful of lines. i f Skips i screenfuls and prints a screenful of lines. q or Q Exits from more. = Displays the current line number. v Starts up the editor vi at the current line. h Help commands; gives a description of all the more commands. i/expr Searches for the i-th occurrence of the regular expression expr. If there are less than i occurrences of expr and the output is a file (rather than a pipe), the position in the file remains unchanged. Otherwise, a screenful is displayed, starting two lines before the place where the expression is found. The user's erase and kill characters may be used to edit the regular expression. Erasing back past the first column cancels the search command. in Searches for the i-th occurrence of the last regular expression entered. Ctrl-L Redraws the screen. ' (Single quote.) Goes to the point from which the last search started. If no search has been performed in the current file, this command goes back to the beginning of the file. !command Invokes a shell with command. The characters "%" and "!" in command are replaced with the current file name and the previous shell command, respectively. If there is no current file name, "%" is not expanded. The sequences "\%" and "\!" are replaced by "%" and "!", respectively. Processed November 8, 1990 MORE, PAGE(1,C) 3 MORE, PAGE(1,C) AIX Commands Reference MORE, PAGE(1,C) i:n Skips to the i-th next file given in the command line (skips to the last file as n does not make sense). i:p Skips to the i-th previous file given in the command line. If this command is given in the middle of printing out a file, more goes back to the beginning of the file. If i doesn't make sense, more skips back to the first file. If more is not reading from a file, the bell rings and nothing else happens. :f Displays the current file name and line number. :q or :Q Exits from more (same as q or Q). . (dot) Repeats the previous command. The commands take effect immediately. For example, it is not necessary to type a carriage return. Up to the time when the command character itself is given, the user may enter the line kill character to cancel the numerical argument being formed. In addition, the user may enter the erase character to redisplay the "--More--(xx%)" message. At any time when output is being sent to the terminal, the user can press the quit key (normally Ctrl-\). The more command stops sending output and displays the usual "--More--" prompt. The user may then enter one of the above commands in the normal manner. Unfortunately, some output is lost when this is done, because any characters waiting in the terminal's output queue are flushed when the quit signal occurs. The terminal is set to noecho mode by this program so that the output can be continuous. What you type, therefore, does not show on the terminal, except for the / and ! commands. If the standard output is not a teletype, more acts just like cat, except that a header is printed before each file (if there is more than one). Both page and more will highlight the "--More--" prompt and then turn off highlighting before the program is exited. This means that a display that uses highlighting or other stand-out modes as a default may be reset so that highlighting is off when the command is exited. EXAMPLE A sample usage of more in previewing nroff output is: nroff -ms -s+2 doc.n|more FILES /usr/lib/terminfo/* Terminal information files /usr/lib/more.help Help file. RELATED INFORMATION See the following commands: "csh," "mail, Mail," and "sh, Rsh." Processed November 8, 1990 MORE, PAGE(1,C) 4 ty k-$X8+o+範-X./usr/man/cat1/pepsy.1..ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH PEPSY 1 "24 Jun 1990" .\" $Header: /f/osi/pepsy/RCS/pepsy.1,v 7.0 90/07/01 19:54:47 mrose Exp $ .\" .\" .\" $Log: pepsy.1,v $ .\" Revision 7.0 90/07/01 19:54:47 mrose .\" *** empty log message *** .\" .SH NAME pepsy \- table driven replacement for posy/pepy .SH SYNOPSIS .in +.5i .ti -.5i .B pepsy \%[\-A] \%[\-a] \%[\-f] \%[\-h\fIoption\fP] \%[\-s] \fImodule.py\fR .in -.5i .SH DESCRIPTION The \fIpepsy\fR program reads a description of a \fIpresentation\fR module and produces definitions and tables for use with the \fIC\fR programming language. It is meant to be backwards-compatible with the \fIposy\fR system. (So, \fIpepsy\fR will ignore any \fIpepy\fR-style augmentations in the input file.) .PP The `\-A' (All) switch directs \fIpepsy\fR to generate tables for encoders, decoders, and printers. .PP The `\-a' switch directs \fIpepsy\fR to augment the #include file with commentary text. .PP The `\-f' switch directs \fIpepsy\fR to generate \fIC\fR macros to deallocate the structures it defines. .PP The `\-h' switch enables additional heuristics when \fIpepsy\fR generates a \fIC\fR language structure definition. Option `0' enables the default heuristics. Enabling any other option also results in enabling option `0'. Option `1' enables \*(lqclever\*(rq but non\-unique structure naming. Option `2' enables the generation of arrays rather than linked-lists whenever possible. .PP Normally, \fIpepsy\fR prints the name of each type as it works. The `\-s' switch disables this behavior. .SH FILES .nf .ta \w'\fImodule\fR_pre_defs.h 'u \fImodule\fR.ph extern type definitions from \fImodule\fR \fImodule\fR_tables.c initialised tables for processing \fImodule\fR \fImodule\fR-types.h \fIC\fR structure definitions from \fImodule\fR \fImodule\fR_pre_defs.h Preprocessor constants for each type in \fImodule\fR \fImodule\fR_defs.h macros to support pepy routines for \fImodule\fR's types .re .fi .SH "SEE ALSO" pepy(1), posy(1), .br \fIThe ISO Development Environment: User's Manual\fR .SH AUTHOR Andrew Worsley, CSIRO and UCL k,$?+_+範-?./usr/man/cat3/libicompat.3.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH LIBICOMPAT 3 "03 Jul 1986" .\" $Header: /f/osi/compat/RCS/libicompat.3,v 7.0 89/11/23 21:23:14 mrose Rel $ .\" .\" .\" $Log: libicompat.3,v $ .\" Revision 7.0 89/11/23 21:23:14 mrose .\" Release 6.0 .\" .SH NAME libicompat \- compatibility library .SH SYNOPSIS \fIcc\fR\0...\0\fB\-licompat\fR .SH DESCRIPTION The \fIlibicompat\fR library makes an attempt of providing an interface for similar services under different operating systems. Currently, the library works on most variants of Berkeley UNIX and AT&T UNIX. .SH FILES None .SH DIAGNOSTICS .SH AUTHOR Marshall T. Rose .SH BUGS To misquote M.A.\0Padlipsky, \*(lqsometimes when you try to make an apple look like an orange you get back something that smells like a lemon.\*(rq e k2$m%+h+範-m%./usr/man/cat3/libpsap.3.3.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH LIBPSAP 3 "15 APR 1986" .\" $header: /f/iso/psap/rcs/libpsap.3,v 4.4 88/05/31 15:19:26 mrose exp $ .\" .\" .\" $log: libpsap.3,v $ .\" revision 4.4 88/05/31 15:19:26 mrose .\" 3n -> 3 .\" .\" revision 4.3 88/05/30 18:30:52 mrose .\" update .\" .\" revision 4.2 88/01/29 14:55:14 mrose .\" touch-up .\" .\" revision 4.1 87/12/28 13:35:24 mrose .\" twg .\" .\" revision 4.0 87/10/12 16:19:59 mrose .\" release 3.0 .\" .SH NAME libpsap \- asn.1 presentation services library .SH SYNOPSIS .B "#include " .sp \fIcc\fR\0...\0\fB\-lpsap\fR .SH DESCRIPTION the \fIlibpsap\fR library contains a set of routines which implement presentation syntax abstractions. two primary objects are manipulated: presentation \fIelements\fR and presentation \fIstreams\fR. .SH "PRESENTATION STREAMS" a stream is an object, similar to a \fBfile*\fR object in \fIstdio\fR\0(3), which is used to read and write elements. a stream is created by calling \fBps_alloc\fR with the address of an integer\-valued routine that will initialize certain stream\-dependent variables (presently, the read and write routines). two standard initialization routines are available: \fBstd_open\fR, which is used for presentation streams connected to \fIstdio\fR objects; and, \fBstr_open\fR, which is used for presentation streams connected to \fIstring\fR objects. after \fBps_alloc\fR successfully returns, final initialization is performed, usually by calling either \fBstd_setup\fR with the \fIstdio\fR object to be bound; or, \fBstr_setup\fR with the string object to be bound. after the setup routine successfully returns, the presentation stream is ready for reading or writing. .PP currently streams which have been initialized by these routines are uni-directional. This might change in a future distribution. Streams which have been initialized by \fBstd_open\fR and \fBstr_open\fR will automatically allocate additional resources when necessary, to the limits allowed by the operating system (e.g., repeated calls to a stream connected to a \fIstring\fR object will result in additional memory being allocated from UNIX). .PP Low\-level I/O is done from/to the stream by the macros \fBps_read\fR and \fBps_write\fR. These both call an internal routine which switches to the object\-specific read or write routine as appropriate. This internal routine, \fBps_io\fR, implements the consistent presentation stream abstraction. .PP Finally, when a stream has been exhausted, it can be closed and de\-allocated with \fBps_free\fR. .PP The user may implement additional stream objects. Examine the source to the \fBstd_\fR and \fBstr_\fR routines to understand the internal protocol and uniform interface. .SH TRANSLATION The routine \fBps2pe\fR can be used to read the next presentation element from a stream. This routine returns a pointer to the element or \fBNULLPE\fR on error. Similarly, \fBpe2ps\fR can be used to write a presentation element at the end of the stream. This returns returns \fBOK\fR if all went well, \fBNOTOK\fR otherwise. On errors with either routine, the \fBps_errno\fR field of the stream can be consulted to see what happened. .PP When writing to a presentation stream, the variable \fBps_len_strategy\fR controls how long CONStructor types are represented. If this variable is equal to \fBPS_LEN_SPAG\fR (the default), then the indefinite form is used whenever the length field of the element can not be represented in one octet. If \fBPS_LEN_INDF\fR, then the indefinite form is used regardless of the length of the element. Otherwise, if \fBPS_LEN_LONG\fR, then the indefinite form is never used. .PP For debugging purposes, instead of treating a presentation stream as a binary object, the routines \fBpl2pe\fR and \fBpe2pl\fR can be used. These translate between presentation \fIlists\fR and presentation elements. A list is an ASCII text representation, with a simple LISP\-like syntax which contains semantic information identical to its presentation stream counterpart. .SH "PRESENTATION ELEMENTS" Once a presentation stream has been initialized and elements are being read, there are several routines that can be used to translate between the machine\-independent representation of the element and machine\-specific objects such as integers, strings, and the like. It is extremely important that programs use these routines to perform the translation between objects. They have been carefully coded to present a simple, uniform interface between machine\-specifics and the machine\-independent presentation protocol. .PP A new element can be created with \fBpe_alloc\fR, and de\-allocated with \fBpe_free\fR (see the warning in the \fBBUGS\fR section below). Two elements can be compared with \fBpe_cmp\fR, and an element can be copied with \fBpe_cpy\fR. .PP A \fIboolean\fR is an integer taking on the values \fB0\fR or \fB1\fR. The routine \fBprim2bool\fR takes an element and returns the boolean value encoded therein. Similarly, \fBbool2prim\fR takes a boolean and returns an element which encodes that value. .PP An \fIinteger\fR is a signed\-quantity, whose precision is specific to a particular host. The routine \fBprim2int\fR takes an element and returns the integer value encoded therein (if the value is \fBNOTOK\fR, check the \fBpe_errno\fR field of the element to see if there was an error). The routine \fBint2prim\fR performs the inverse operation. .PP An \fIoctetstring\fR is a pair of values, a character pointer and an integer length. The pointer addresses the first octet in the string (which need not be null\-terminated), the length indicates how many octets are in the string. The routine \fBprim2oct\fR takes an element and allocates a new string containing the value encoded therein. The routine \fBoct2prim\fR performs the inverse operation, copying the original string (and not de\-allocating it). .PP A \fIbitvector\fR is an arbitrarily long string of bits with three operations: \fBbit_on\fR which turns the indicated bit on, \fBbit_off\fR which turns the indicated bit off, and, \fBbit_test\fR which returns a boolean value telling if the indicated bit was on. The routine \fBprim2bit\fR takes an element and builds such an abstraction containing the value encoded therein. The routine \fBbit2prim\fR performs the inverse operation. .PP A \fItimestring\fR represents a date/time in many forms. Consult \fB\fR for the elements in this structure. The routines \fBprim2utc\fR and \fButc2prim\fR are used to translate between a machine\-specific internal form and the machine\-independent form. .PP Two list disciplines are implemented: \fIsets\fR, in which each member is distinguished by a unique identifier; and, \fIsequences\fR, in which each element is distinguished by its offset from the head of the list. On both types of lists, the macro \fBfirst_member\fR returns the first member in the list, while \fBnext_member\fR returns the next member. .PP The routines \fBprim2set\fR and \fBset2prim\fR are used to translate between presentation elements and the set list; \fBset_add\fR may be called to add a new member to the set; \fBset_del\fR may be called to remove the identified member from the set; and, \fBset_find\fR may be called to locate the identified member. .PP The routines \fBprim2seq\fR and \fBseq2prim\fR are used to translate between presentation elements and the sequence list; \fBseq_add\fR may be called to add a new element to the sequence; \fBseq_del\fR may be called to remove the identified element from the sequence; and, \fBseq_find\fR may be called to locate the identified element. .PP With both lists, a convenient way of stepping through all the members is: .sp .in +.5i .nf .B "for (p = first_member (pe); p; p = next_member (pe, p))" .B "\0\0\0\0switch (\fIdiscriminator\fR) {" .B "\0\0\0\0\0\0\0\0...." .B "\0\0\0\0}" .fi .in -.5i .sp where \fIdiscriminator\fR is: .sp .in +.5i .B "PE_ID (p \-> pe_class, p \-> pe_id)" .in -.5i .sp for sets, and: .sp .in +.5i .B "p \-> pe_offset" .in -.5i .sp for sequences. .SH FILES None .SH "SEE ALSO" pepy(1), .br \fIThe ISO Development Environment: User's Manual\fR, .br ISO 8825: \fIInformation Processing \-\- Open Systems Interconnection \-\- Specification of basic encoding rules for Abstract Syntax Notation One (ASN.1)\fR, .br CCITT Recommendation X.409: \fIMessage Handling Systems: Presentation Transfer Syntax and Notation\fR .SH DIAGNOSTICS Most routines either return the manifest constant \fBNULL\fR (0) or \fBNOTOK\fR (\-1) on error. In addition, routines called with a pointer to a presentation stream also update the \fBps_errno\fR field of the stream on error. The routine \fBps_error\fR returns a null\-termianted diagnostic string when given the value of this field. Similarly, routines called with a pointer to a presentation element also update the \fBpe_errno\fR field of the stream on error. The routine \fBpe_error\fR returns a null\-termianted diagnostic string when given the value of this field. .SH AUTHOR Marshall T. Rose .SH BUGS A \*(lqvirtual\*(rq presentation element option should be available to avoid reading everything in\-core during parsing. .PP When using \fBpe_free\fR on an element, care must be taken to remove any references to that element in other structures. For example, if you have a sequence containing a sequence, and you free the child sequence, be sure to zero\-out the parent's pointer to the child, otherwise subsequent calls using the parent will go romping through hyperspace. per k $+b+範-c./usr/man/cat3/libtsap.3n3.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH LIBTSAP 3N "31 May 1988" .\" $Header: /f/osi/tsap/RCS/libtsap.3n,v 7.0 89/11/23 22:30:28 mrose Rel $ .\" .\" .\" $Log: libtsap.3n,v $ .\" Revision 7.0 89/11/23 22:30:28 mrose .\" Release 6.0 .\" .SH NAME libtsap \- Transport Services library .SH SYNOPSIS .B "#include " .sp \fIcc\fR\0...\0\fB\-ltsap\fR .SH DESCRIPTION The \fIlibtsap\fR library contains a set of routines which implement transport services on top of the TCP. In essence, they implement a Transport Service Access Point (TSAP) interface to the native TCP/IP implementation on Berkeley UNIX. .PP Although the ISO model is symmetric, the TCP/IP model (and this implementation) is based on a client/server paradigm and hence asymmetric. The information herein is skeletal: consult the \fIUser's Manual\fR for actual examples of how ISO servers and clients are coded and interact with the \fIlibtsap\fR library. .SH ADDRESSES TSAP addresses are represented by the \fBTSAPaddr\fR structure. This contains one more more network addresses, and a transport-selector as found in the \fIisoservices\fR\0(5) database. .SH "SERVER INITIALIZATION" A program providing an ISO service is invoked under \fItsapd\fR\0(8c), with the argument vector listed in the ISODE services database. The server's very first action is to re\-capture the TSAP state as recorded by \fItsapd\fR. This is accomplished by calling \fBTInit\fR. Information returned by this call is equivalent to the parameters passed by a T\-CONNECTION.INDICATION event. If the call is successful, the program can then examine the argument vector that was passed via \fIexecvp\fR (it's important to call \fBTInit\fR prior to reading \fBargc\fR and \fBargv\fR). If the call to \fBTInit\fR is not successful, information returned by the call indicates the reason for failure. .PP After examining the information provided by \fBTInit\fR (and possibly the argument vector), the server should either accept or reject the connection. If accepting, the \fBTConnResponse\fR routine is called (which corresponds to the T\-CONNECT.RESPONSE action). If the call is successful, the interaction is henceforth symmetric. If un\-successful, information returned by the call indicates the reason for failure. If rejecting, the \fBTDiscRequest\fR routine is called (which corresponds to the T\-DISCONNECT.REQUEST action), and the program may exit. .SH "CLIENT INITIALIZATION" A program requesting an ISO service calls \fBTConnRequest\fR (which corresponds to the T\-CONNECT.REQUEST action). If successful, the interaction is henceforth symmetric. If un\-successful, information returned by the call indicates the reason for failure. .SH TRANSPORT\-DESCRIPTORS Once a connection has been established via a successful return from \fBTConnResponse\fR (for servers) or \fBTConnRequest\fR (for clients), a connection is referenced by a small integer (returned in a structure passed to these calls) called a \fItransport\-descriptor\fR. The transport\-descriptor appears as an argument to the peer routines described below. .PP By default, events associated with a transport\-descriptor are synchronous in nature: activity in the network won't generate an INDICATION event without program first asking to be told of any activity. To mark a transport\-descriptor as asynchronous, a call to \fBTSetIndications\fR is made with the addresses of an integer function to handle these events: .sp .in +.5i .nf .ta \w'\fIroutine\fR 'u \fIroutine\fR \fIevents\fR \fBfunc1\fR T\-DATA.INDICATION, T\-EXPEDITED DATA.INDICATION \fBfunc2\fR T\-DISCONNECT.INDICATION .re .fi .in -.5i .sp Upon a successful return from \fBTSetIndications\fR, these functions will be called as appropriate in this fashion: .sp .in +.5i .B "(*func1) (sd, tx);" .sp .B "(*func2) (sd, td);" .in -.5i .sp where \fBsd\fR is the transport\-descriptor, \fBtx\fR is a pointer to a \fBTSAPdata\fR structure, and \fBtd\fR is a pointer to a \fBTSAPdisconnect\fR structure. Any value returned by these functions is ignored. .PP Note well: the \fB\-ltsap\fR library uses the SIGEMT signal to provide this interface. Programs loaded with \fB\-ltsap\fR that use asynchronous transport\-descriptors should NOT use SIGEMT for other purposes. .PP For synchronous multiplexing of several connections, the routine \fBTSelectMask\fR updates a file\-descriptor mask and counter for use with \fIselect\fR\0(2). .SH PEER As a rule, a fatal failure (consult the \fIUser's Manual\fR) on return from any of these routines is equivalent to a T\-DISCONNECT.INDICATION. .sp .in +.5i .nf .ta \w'\fBTWriteRequest\fR 'u \fIroutine\fR \fIaction\fR \fBTDataRequest\fR T\-DATA.REQUEST \fBTExpdRequest\fR T\-EXPEDITED\-DATA.REQUEST \fBTWriteRequest\fR T\-WRITE.REQUEST (write user data vectors) \fBTReadRequest\fR T\-READ.REQUEST (synchronous read) \fBTDiscRequest\fR T\-DISCONNECT.REQUEST .re .fi .in -.5i .sp Note that the \fBTReadRequest\fR routine returns data from the peer by allocating memory. It should be freed before the structure is re\-used. .PP Finally, the routine \fBTErrString\fR takes a failure code from a \fBTSAPdisconnect\fR structure and returns a null\-terminated diagnostic string. Also, the routine \fBTLocalHostName\fR returns a null\-terminated string denoting the name of the localhost. .SH FILES .nf .ta \w'\*(EDisoservices 'u \*(EDisoservices ISODE services database .re .fi .SH "SEE ALSO" isoc(1c), isoservices(5), isod(8c), isore(8c), tsapd(8c), .br \fIThe ISO Development Environment: User's Manual\fR, .br \fIRFC1006: ISO Transport Services on top of the TCP, Version: 3\fR, .br ISO 8072: \fIInformation Processing Systems \-\- Open Systems Interconnection \-\- Transport Service Definition\fR, .br CCITT Recommendation X.214: \fITransport Service Definition for Open Systems Interconnection (OSI) for CCITT Applications\fR .SH DIAGNOSTICS All routines return the manifest constant \fBNOTOK\fR (\-1) on error. In addition, those routines which take a pointer to a \fBTSAPdisconnect\fR structure fill\-in the structure as appropriate. .SH AUTHORS Marshall T. Rose .br Dwight E. Cass, Northrop Research and Technology Center .SH BUGS Do not confuse transport\-descriptors with file\-descriptors. Unlike file\-descriptors which are implemented by the kernel, transport\-descriptors do not work across \fIfork\fRs and \fIexec\fRs. reas kM$+z+鯄- ./usr/man/cat5/isoaliases.5.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOALIASES 5 "11 Jun 1988" .\" $Header: /f/osi/support/RCS/isoaliases.5,v 7.1 90/07/09 14:50:41 mrose Exp $ .\" .\" .\" $Log: isoaliases.5,v $ .\" Revision 7.1 90/07/09 14:50:41 mrose .\" sync .\" .\" Revision 7.0 89/11/23 22:27:12 mrose .\" Release 6.0 .\" .SH NAME .B isoaliases \- ISODE aliases database .SH DESCRIPTION The \fIisoaliases\fR file contains information regarding local aliases for either user-friendly names or distinguished names for use with the OSI Directory. .PP Items are separated by any number of blanks and/or tab characters. However, double\-quotes may be used to prevent separation between arguments. The character `#' at the beginning of a line indicates a comment line. .PP The first item is the alias, a simple string. The second item is the value. .SH "USER-SPECIFIC ALIASES" By default a user-specific aliases database is consulted before the system\-wide aliases file. The user-specific file is called \fB\&.isode_aliases\fR in the user's home directory. .SH FILES .nf .ta \w'$HOME/.isode_aliases 'u \*(EDisoaliases ISODE aliases database $HOME/.isode_aliases user-specific aliases database .re .fi .SH "SEE ALSO" dsabuild(8c), .br \fIThe ISO Development Environment: User's Manual, Volume 1: Application Services\fR, \*(lqThe ISODE Aliases Database\*(rq. .SH AUTHOR Marshall T. Rose T k$>+|+鯄->./usr/man/cat5/isobjects.5.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOBJECTS 5 "23 Jul 1987" .\" $Header: /f/osi/support/RCS/isobjects.5,v 7.0 89/11/23 22:27:13 mrose Rel $ .\" .\" .\" $Log: isobjects.5,v $ .\" Revision 7.0 89/11/23 22:27:13 mrose .\" Release 6.0 .\" .SH NAME .B isobjects \- ISODE objects database .SH DESCRIPTION The \fIisobjects\fR file contains information regarding the known objects on the host. .PP Items are separated by any number of blanks and/or tab characters. However, double\-quotes may be used to prevent separation between arguments. The character `#' at the beginning of a line indicates a comment line. .PP The first item is the descriptor of the object, a simple string. The second item is the corresponding object identifier. .SH FILES .nf .ta \w'\*(EDisobjects 'u \*(EDisobjects ISODE objects database .re .fi .SH "SEE ALSO" isoentities(5), isoservices(5), .br \fIThe ISO Development Environment: User's Manual, Volume 1: Application Services\fR, \*(lqThe ISODE Objects Database\*(rq. .SH AUTHOR Marshall T. Rose ct kX$ +{+鯄- ./usr/man/cat5/isoentities.5.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOENTITIES 5 "31 May 1988" .\" $Header: /f/osi/support/RCS/isoentities.5,v 7.1 90/10/15 22:54:22 mrose Exp $ .\" .\" .\" $Log: isoentities.5,v $ .\" Revision 7.1 90/10/15 22:54:22 mrose .\" typo .\" .\" Revision 7.0 89/11/23 22:27:31 mrose .\" Release 6.0 .\" .SH NAME .B isoentities \- ISODE entities database .SH DESCRIPTION The \fIisoentities\fR file contains information regarding the known application-entity titles (AETs). This file is used by the stub\-directory service in ISODE. .PP \fBNB\0\fR: Use of this database is deprecated. Consult the ISODE \fIUser's Manual\fR for further information. .PP Entries are separated by blank lines (or the end\-of\-file). Items are separated by any number of blanks and/or tab characters, though double\-quotes may be used to prevent separation between arguments. The character `#' at the beginning of a line indicates a comment line. .PP Each entry consists of four items: the first two, the designator and qualifier, for the object descriptor of the application-entity information (the distinguished designator \*(lqdefault\*(rq is used for a template entry); the third item is the object identifier of application-entity information in dot-notation (if no application-entity information is desired the string \*(lqNULL\*(rq should be used instead); and the fourth item is the entire presentation address expressed using the ISODE string format. Note that since double-quotes are often used in the new string format, it is \fBvery\fR important to quote them correctly in the \fIisoentities\fR file. Usually preceeding the first character of the address with single backslash is adequate. .PP It is suggested for readability purposes that a blank line should seperate entries. .PP Note that this database is used by the stub-directory service in ISODE. A real directory uses an entirely different mechanism for resolving lookups. The stub-directory mechanism in ISODE transforms the internal AET notion (the object identifiers) into one which appears to have come from a real directory (i.e., application-entity information). .SH "RFC1085 SUPPORT" Since applications using RFC1085 (the lightweight presentation protocol) usually demultiplex on the basis of TCP or UDP port, a further definition for the qualifier is placed in \fI/etc/services\fR, one of: .sp .in +.5i .nf qualifier portno/lpp qualifier portno/tcp qualifier portno/udp .fi .in -.5i .sp The first alternative says that the service lives on both TCP and UD; the second alternative says that the service lives on TCP only; and, the third alternative says that the service lives on UDP only. .SH FILES .nf .ta \w'\*(EDisoentities 'u \*(EDisoentities ISODE entities database .re .fi .SH "SEE ALSO" isobjects(5), isoservices(5), .br \fIThe ISO Development Environment: User's Manual, Volume 1: Application Services\fR, \*(lqThe ISODE Entities Database\*(rq. .SH AUTHOR Marshall T. Rose .br with design conceptualization by Stephen E. Kille, University College London. the kt*$+|+鯄-./usr/man/cat5/isomacros.55.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOMACROS 5 "12 Feb 1989" .\" $Header: /f/osi/support/RCS/isomacros.5,v 7.0 89/11/23 22:27:33 mrose Rel $ .\" .\" .\" $Log: isomacros.5,v $ .\" Revision 7.0 89/11/23 22:27:33 mrose .\" Release 6.0 .\" .SH NAME .B isomacros \- ISODE macros database .SH DESCRIPTION The \fIisomacros\fR file contains information regarding local macros for network addresses. .PP Items are separated by any number of blanks and/or tab characters. However, double\-quotes may be used to prevent separation between arguments. The character `#' at the beginning of a line indicates a comment line. .PP The first item is the macro, a simple string. The second item is the prefix for the corresponding network address. .SH "USER-SPECIFIC MACROS" By default a user-specific macros database is consulted before the system\-wide macros file. The user-specific file is called \fB\&.isode_macros\fR in the user's home directory. .SH FILES .nf .ta \w'$HOME/.isode_macros 'u \*(EDisomacros ISODE macros database $HOME/.isode_macros user-specific macros database .re .fi .SH "SEE ALSO" isoentities(5), .br \fIThe ISO Development Environment: User's Manual, Volume 1: Application Services\fR, \*(lqThe ISODE Macros Database\*(rq, .br \fIA string encoding of Presentation Address\fR, S.E. Kille .br \fIAn Interim approach to use of Network Addresses\fR, S.E. Kille .SH AUTHOR Marshall T. Rose expr k1$+}+鯄-./usr/man/cat5/isoservices.5.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOSERVICES 5 "08 Apr 1986" .\" $Header: /f/osi/support/RCS/isoservices.5,v 7.1 90/10/15 22:54:23 mrose Exp $ .\" .\" .\" $Log: isoservices.5,v $ .\" Revision 7.1 90/10/15 22:54:23 mrose .\" typo .\" .\" Revision 7.0 89/11/23 22:27:35 mrose .\" Release 6.0 .\" .SH NAME .B isoservices \- ISODE services database .SH DESCRIPTION The \fIisoservices\fR file contains information regarding the known services on the host. .PP \fBNB\0\fR: Use of this database is deprecated. Consult the ISODE \fIUser's Manual\fR for further information. .PP Items are separated by any number of blanks and/or tab characters. However, double\-quotes may be used to prevent separation between arguments in the vector. The character `#' at the beginning of a line indicates a comment line. .PP Each line consists of the name of the provider, a slash, and the name of the entity residing above the provider; the selector used to identify the entity to the provider; and, the program and argument vector to \fIexecvp\fR when the service is requested. If the selector starts with a hash\-mark (`#') it is interpreted numerically as a decimal short-word quantity; otherwise if it appears in double\-quotes, it is interpreted as an ascii string, with the usual escape mechanisms for introducing non\-printable characters; otherwise, it is interpreted as an exploded octet string. .SH FILES .nf .ta \w'\*(EDisoservices 'u \*(EDisoservices ISODE services database .re .fi .SH "SEE ALSO" isoentities(5), isobjects(5), .br \fIThe ISO Development Environment: User's Manual, Volume 2: Underlying Services\fR, \*(lqThe ISODE Service Database\*(rq. .SH AUTHOR Marshall T. Rose It is k$>/+~+鯄->/./usr/man/cat5/isotailor.55.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH ISOTAILOR 5 "5 July 1988" .\" $Header: /f/osi/support/RCS/isotailor.5,v 7.5 90/07/09 14:50:51 mrose Exp $ .\" .\" .\" $Log: isotailor.5,v $ .\" Revision 7.5 90/07/09 14:50:51 mrose .\" sync .\" .\" Revision 7.4 90/01/11 18:38:00 mrose .\" real-sync .\" .\" Revision 7.3 89/12/12 16:14:33 mrose .\" localHost .\" .\" Revision 7.2 89/11/30 23:51:52 mrose .\" typo .\" .\" Revision 7.1 89/11/27 10:30:48 mrose .\" sync .\" .\" Revision 7.0 89/11/23 22:27:37 mrose .\" Release 6.0 .\" .SH NAME .B isotailor \- ISODE tailoring file .SH DESCRIPTION The \fIisotailor\fR file contains information used to run-time configure the ISODE distribution. Entries are separated by end\-of\-line (or the end\-of\-file). The character `#' at the beginning of a line indicates a comment line. The syntax is: .sp .in +.5i .nf variable: value .fi .in -.5i .sp as in .sp .in +.5i .nf sbindir: /usr/etc/ .fi .in -.5i .PP The entries come in several types. There are general ISODE configuration parameters, operating system specific tailoring and interface specific tailoring parameters. .SH "LOCAL ENVIRONMENT TAILORING" There are some variables that are used to make up for deficiencies in operating systems, or to override the operating system. These are described as follows. .IP localname This takes a string as a parameter and is used as the name of the local host if the \fIgethostname\fR call (or equivalent, e.g., \fIuname\fR) is not used. This will also override any other run-time determination of the local hostname. .IP binpath This takes a string as a parameter and indicates the directory where the ISODE user programs are kept (be sure to use a trailing slash). .IP sbinpath This takes a string as a parameter and indicates the directory where the ISODE system programs are kept (be sure to use a trailing slash). .IP etcpath This takes a string as a parameter and indicates the directory where the ISODE configuration files are kept (be sure to use a trailing slash). .SH "LOGGING TAILORING" There are a number of options that can be set for each layer of ISODE. The first variable indicates the default logging directory, the other variables give information about each log file. .IP logpath This variable takes a string as a parameter and indicates the directory where the ISODE log files are kept (be sure to use a trailing slash). .PP The remaining variables are all configured in the same way and are in the general format: .sp .in +.5i .nf xyzlevel: [none] [exceptions] [notice] [pdus] [trace] [debug] [all] xyzfile: filename .fi .in -.5i .sp The filename can be either the name of a file of a `\-' in which case the standard error is used. If the filename contains the string `%d' then this is replaced by the current process id. .PP The normal level for this style of tailoring is to set exceptions. The other two values can be added in when debugging, if so desired. The current variables in this format are as follows. .sp .in +.5i .nf .ta \w'compatlevel 'u compatlevel native services subsystem compatfile addrlevel addressing subsystem addrfile tsaplevel transport level tsapfile ssaplevel session level ssapfile psaplevel presentation elements psapfile psap2level presentation level psap2file acsaplevel association control level acsapfile rtsaplevel reliable transfer level rtsapfile rosaplevel remote operations level rosapfile .sp .in -.5i .fi .SH "TRANSPORT STACK TAILORING" There are several variables which can be used to en/disable configured TS-stacks and to define OSI communities and their relationship to this system. .SS "TS-STACKS" .IP ts_stacks which takes one or more of the following values: .sp .in +.5i .nf [tcp] [x25] [bridge] [tp4] [all] .fi .in -.5i .sp indicates which TS-stacks should be enabled. This is useful when multiple machines (with different interfaces) share the same executables. For example, the \fB\*(EDisotailor\fR file is a normally symbolic link to \fB/private\*(EDisotailor\fR. .SS "OSI COMMUNITIES" .IP ts_interim which takes one or more OSI community names as a value. Each community name must be defined as a macro in the \fIisomacros\fR\0(5) file. .IP ts_communities which takes one or more of the following values: .sp .in +.5i .nf [int-x25] [janet] [internet] [realns] [localTCP] [all] .fi .in -.5i .sp This variable is used to distinguish membership in various OSI communities. For example, a site with an X.25 connection might be attached to the International X.25 network, but not the JANET. Thus \fIts_stacks\fR would include \*(lqx25\*(rq, and \fIts_communities\fR would include \*(lqint-x25\*(rq but not \*(lqjanet\*(rq. Note that the ordering of communities is important: network addresses will be tried in the order that their respective communities are listed with this variable. .IP default_nsap_community which takes an integer value, declaring the default community to be used for NSAP addresses. .IP default_x25_community declaring the default community to be used for X.25 (DTE) addresses. .IP default_tcp_community declaring the default community to be used for TCP (RFC1006) addresses. .SS "TS-BRIDGE" These are the parameters that are used in the Transport-Service Bridge implementation. .IP tsb_communities A list of pairs of values. The first of each value should be a community as defined in the \fIts_communities\fP variable (obviously the values \*(lqnone\*(rq and \*(lqall\*(rq are not permissible). The second value of the pair should be a presentation address using the ISODE \*(lqstring\*(rq format. When a call is to be placed and the network corresponds to one of the communities given here, then a call through the bridge given in the second variable will be made automatically. .IP tsb_default_address This variable contains a string encoded presentation address which the bridge will listen on by default. This should normally consist of a set of network addresses with no selectors present. .PP Consider the case of a host with access to both the Internet and the International X.25 network. This host might have this entry in its \fIisotailor\fR file: .sp .in +.5i .nf tsb_default_address: Internet=sheriff+17004\\|Int-X25(80)=23426020017299+PID+03018000 .fi .in -.5i .sp This tells the bridge to listen on two network endpoints. Hosts in the Internet community wishing to reach the International X.25 community would have this entry in their \fIisotailor\fR file: .sp .in +.5i .nf tsb_communities: int-x25 Internet=sheriff+17004 .fi .in -.5i .sp Similarly, hosts in the International X.25 community wishing to reach the Internet community, would have the entry: .sp .in +.5i .nf tsb_communities: internet Int-X25(80)=23426020017299+PID+03018000 .fi .in -.5i .SH "INTERFACE SPECIFIC TAILORING" Most interfaces that ISODE runs over have some form of tailoring. These are usually very dependent on the interface. Each interface which supports tailoring will now be described. .SS "General X.25 Tailoring" There are two specific variables that can be used with any X.25 interface. .IP x25_local_dte This is the X.121 address that ISODE processes will listen on by default. It may be a full X.121 address or a sub-address. .IP x25_local_pid This is the X.25 protocol ID that ISODE processes will listen on by default. Traditionally, this is the first four octets of the CUDF in hex-notation, e.g., 03010100. .PP There are also three variables for performing address manipulation as required by some network vendors. .IP x25_intl_zero If this has the value `on' then any international DTEs (i.e. having non\-local DNICs) will have a leading zero introduced before being passed to the network. .IP x25_strip_dnic If this has the value `on' then any local DTEs (i.e. having the local DNIC) will have this DNIC removed before being passed to the network. .IP x25_dnic_prefix This should be set to the local DNIC (the first four digits of the DTE) of the host machine. It should only be set if one or both of the previous two variables has the value `on'. .PP There are also two variables for logging X.25 statistics. .IP x25level Defines the level of logging to be used for X.25 statistics logging. (At present, only \*(lqnotice\*(rq level messages are generated.) .IP x25file Defines the filename to be used for X.25 statistics logging. .SS "SUNLINK X.25" These setting are only useful when SUN_X25 is defined along with X25. The effect of these parameters is more fully documented in the Sun manuals. .IP reverse_charge Set to 1 or 0 to enable/disable reverse charging. .IP recvpktsize .IP sendpktsize This should be set to one of 0 (default), 16, 32, 64, 128, 256, 512 or 1024 to set the send/receive packet size. .IP recvwndsize .IP sendwndsize This sets the send/receive window sizes. Legal values are 0 (default), 7 and 127. .IP recvthruput .IP sendthruput This sets the sending/receiving throughput values. Legal values are 0 (default) 75, 150, 300, 600, 1200, 2400, 4800, 9600, 19200, 48000. .IP cug_req Closed user group request. Set to either 0 or 1. .IP cug_index Sets the closed user group index number. .IP fast_select_type Sets the fast select parameters. Either 0, 1 or 2. .IP rpoa_req .IP rpoa Recognised private operating agency parameters. .SS "CAMTEC CCL" These are used when the Camtec X.25 is accessed via the CCL (sockets) mechanism. .IP x25_outgoing_port This selects which port on the Camtec card will be used for outgoing calls, and takes the value A, B or #. A and B are the two X.21 WAN interfaces and # is the Ethernet. Listening is automatically done on all three ports. .SS "BRIDGE X.25" These are parameters that are used in the tp0bridge implementation. .IP x25_bridge_host The host machine that is running the tp0bridge. .IP x25_bridge_port This is the TCP port that is to be used for bridging. The default is 146, which should be in defined in /etc/services. .IP x25_bridge_addr The X.121 address of the remote host. .IP x25_bridge_listen The X.121 address to listen on for incoming calls, on the remote host. .IP x25_bridge_pid The protocol ID used for listening along with the previous address. This is encoded as a string of eight hex digits. .IP x25_bridge_discrim A string used to discriminate the network. When attempting to place an X.25 call with BRIDGE_X25 and real X25 configured in, this string is used to decide which interface to use. If the string is empty, the bridge will be used. If it is set to `\-' the bridge will not be used. If the string is anything else, it is compared against the called X.121 address. If there is a match, then the bridge is used, otherwise the real interface is used. .SH "DIRECTORY SERVICES TAILORING" There are two variables that can be tailored: .IP ns_enable This takes either the string \*(lqon\*(rq or \*(lqoff\*(rq as a parameter. If \*(lqon\*(rq, then the \*(lquser-friendly namservice" will be used to perform name/address resolution. If the nameservice lookup fails, the stub-directory will be used as a fallback. .IP ns_address This is the transport address of the nameservice. It is specified using the ISODE \*(lqstring\*(rq format, e.g., .in +.5i Internet=wp.psi.com+17006 .in -.5i which indicates that the nameservice lives in the TCP/IP communications domain on TCP port \*(lq17006\*(rq at host \*(lqwp.psi.com\*(rq. The nameservice is accessed via the OSI CO-mode transport service, so other kinds of addresses (e.g., X.25 addresses can be used as well). .SH "PROGRAM-SPECIFIC TAILORING" By default a program-specific tailoring file is consulted before the system\-wide tailoring file. The program-specific file is called \fB\&.myname_tailor\fR in the user's home directory, where \*(lqmyname\*(rq is the name that the program was invoked with. .SH FILES .nf .ta \w'$HOME/.myname_tailor 'u \*(EDisotailor ISODE tailoring file $HOME/.myname_tailor program-specific tailoring file .re .fi .SH "SEE ALSO" \fIThe ISO Development Environment: User's Manual, Volume 2: Underlying Services\fR, \*(lqThe ISODE Tailoring File\*(rq. .SH AUTHORS Marshall T. Rose .br Simon Walton, University College London r k,J$SG+-+鯄-S./usr/man/cat5/sendmail.cf.5 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) ------------------------------------------------------------------------------- sendmail.cf PURPOSE Contains sendmail configuration file data. DESCRIPTION The configuration file contains the configuration information for the sendmail program. The configuration information includes such items as the host name and domain and the sendmail rule sets. The configuration file has three major purposes: o To initialize the environment for sendmail by setting the options o To rewrite addresses in messages by first mapping the addresses from any format into a canonical form and then mapping the canonical form into the appropriate syntax for the receiving mailer. o To translate the address into the set of instructions needed to deliver the message. The configuration file entries consist of lines, each of which begins with a single character command. Entries can continue onto multiple lines by placing blanks at the beginning of each subsequent line. Comments are included on lines beginning with the # (sharp sign). The commands and operands are: CX word1 word2 ... Defines the class, specified by X, of words to match on the left hand side of rewriting rules. Class specifiers may be any of the uppercase letters from the ASCII character set. Lowercase letters and special characters are reserved for system use. DX value Defines the macro specified by X and its associated value. A macro is named using a single character. The character may be any character from the ASCII character set, but user-defined macros can only use the uppercase letters. Lowercase letters and special characters are reserved for system use. Macros can be interpolated in most places using the escape sequence $x. See "Special Macros" for additional information. FX filename [format] Reads the elements of the class specified by X from filename using an optional scanf format specifier. H[?mflags?]hdrname: htemplate Processed February 11, 1993 SENDMAIL.CF(5,F) 1 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) Defines the header format the sendmail program inserts into a message. Continuation lines are a part of the definition and write into the outgoing message. The htemplate is macro expanded before insertion into the message. If the mflags are specified, at least one of the specified flags must be stated in the mailer definition for this header to be automatically output. If one of these headers is in the input, the header writes into the output message regardless of these flags. Mname, [field=value]* Defines a mailer where name is the name of the mailer (used internally only) and field=value defines attributes of the mailer. Allowable fields and values are: P=value Defines the path name of the mailer, where value is the path name. SMTP internal mail uses a value of [IPC]. F=value Defines the special flags for this mailer, where value can be a string composed of the following: C Saves the sender domain. For this function only, the sender domain is defined to be everything from the first @ (at sign) to the end of the sender address. This string is appended to header addresses which contain no @ whenever mail is sent to any mailer. This also applies to calculation of the $g macro and everything dependent on it. This flag offsets the SMTP mail and rcpt commands. e This mailer is expensive to connect to. Avoid connecting normally. Any necessary connection will occur during a queue run. See the c option on 4. E Escape "From" lines to >"From" in message bodies. f The mailer wants a -f (from) flag only if this is a network forward operation (for example, the mailer gives an error if the executing user does not have special permissions). h Preserves uppercase in host names for this mailer. I Uses SMTP to communicate with another sendmail and can use special protocol features. l This mailer is local; final delivery is performed. L Limits the line length of a text line to less than 1000 characters. Any leading dot duplicated due to the X flag is not included in the count. Only allows 7-bit data to pass either way through the mailer. Processed February 11, 1993 SENDMAIL.CF(5,F) 2 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) m This mailer can send to multiple users on the same host in one transaction. When a $u macro occurs in the A part of the mailer definition, that field will be repeated as necessary for all qualifying users. n The AIX-style "From" line on the front of the message is not inserted. N International Character Support. Only has meaning when used with the L flag. Allows 8-bit data to pass. p Uses the return-path in the SMTP MAIL FROM: command rather than just the return address. R Try to send on a reserved TCP port. r Same as option f except a -r flag is generated. s Strips quote characters off of the address before calling the mailer. S User ID is not reset before calling the mailer. u Preserves uppercase in users names for this mailer. U Requires "From" lines with UUCP-style remote from host on the end. X This mailer uses the hidden-dot algorithm. (Any line beginning with a dot has an extra dot prepended. This ensures that the lines in the message containing a leading dot will not terminate the message prematurely. See the sendmail -i flag or the config option. S=value The rewriting rule set to be used for sender addresses, where value is the rewriting rule set number. R=value The rewriting rule set to be used for recipient addresses, where value is the rewriting rule set number. A=arg Defines the argument string arg to exec the mailer with. Embedded spaces may be included. If embedded spaces are used, enclose the argument string with " (double quotes). For an SMTP mailer, A=[IPC]. E=string Defines the string to use as an end-of-line indication. A string containing only new-line is the default. M=length Defines the maximum message length to be sent to the mailer. Processed February 11, 1993 SENDMAIL.CF(5,F) 3 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) Ox[value] Sets option x to value. If the option is a valued option, you must also specify value. Options may also be selected from the command using the -o flag of the sendmail command. The options and the possible values are described as follows: Afile Uses the named file as the alias file. a Look N minutes for "@:@" in alias file. Bc Sets the blank substitution character to the character specified in the parameter c. The sendmail program replaces unquoted spaces in addresses with this character. The supplied configuration file uses the . (period) for this character. C Checkpoint after N connections. c If an outgoing mailer is marked as being expensive to use, this option causes sendmail to queue messages for that mailer program without sending them. The queue can be run later when costs are lowest or when the queue is large enough to send the message efficiently. D Rebuild alias database as needed. dx Sets the delivery mode to x. Valid modes are: b Deliver in background (asynchronously). This is the default setting. i Deliver interactively (synchronously) q Queue the message only and deliver during queue run. E Storage attributes for files in replicated system. ex Sets error processing to mode x. Valid modes are: e Mails the error message to the user's mail box, but always exits with a 0 exit status (normal return). m Mails the error message to the user's mail box. p Displays the error message on the terminal (default). q Discards the error message and returns the exit status only. w Writes the error message to the terminal or mails it if the user is not logged in. Fx File mode of temporary copy of message. f Saves "From" lines at the front of messages. These lines are normally discarded. Causes all other headers to be regarded as part of the message body. Processed February 11, 1993 SENDMAIL.CF(5,F) 4 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) gN Sets the default group ID to use when calling mailers to the value specified by N. hdir Absolute name of "master" queue. Hfile Specifies the name of the SMTP help file. i Does not interpret a . (period) on a line by itself as a message terminator. Removes the excess dot inserted by a remote mailer at the beginning of a line, if mail is received through SMTP. In addition, if receiving mail through SMTP, any dot at the front of a line followed by another dot is removed. This is the opposite of the action performed by the X mailer flag. Ix Use Internet domain name server. Ln Specifies the log level to be the value supplied in the n parameter. Each number in the following list includes the activities of all numbers of lesser value and adds the activity that it represents. Valid levels and the activities they represent are: 0 No logging 1 Major problems only 2 Message collections and failed deliveries 3 Successful deliveries 4 Messages being deferred 5 Placing messages in the queue 6 Unusual but benign incidents 9 Log internal queue ID to external message ID mappings 12 Several messages that are of interest when debugging 16 Verbose information regarding the queue. m If the sender is in an alias expansion, also send to the sender. Mx value Defines macro x to have value. This option is normally used only from the sendmail command line. n Validates the RHS of aliases when performing the newaliases function. Processed February 11, 1993 SENDMAIL.CF(5,F) 5 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) Nnetname Sets the name of the host network to netname. The sendmail program compares the argument of an SMTP HELO command to hostname.netname (value of hostname comes from the kernel). If these values do not match, it adds the hostname.netname string to the "Received:" line in the message so that messages can be traced accurately. o Indicates that this message may have old style headers. Without this option, the message has new style headers (commas instead of spaces between addresses). If this option is set, an adaptive algorithm correctly determines the header format in most cases. ppath Path name of alias file. Paddress Identifies the person who is to receive a copy of all returned mail. qfactor Use factor to decide when to queue messages rather than send them. This value is divided by the difference between the current load average and the load average limit (see the x option below) to determine the maximum message priority that will be sent. The default value is 10000. Qdir Sets the directory in which to queue messages. The directory will be created if it does not exist. rtime Sets the timeout for reads from a mailer program to the value specified by time. If no timeout value is set, sendmail waits indefinitely for a mailer to respond. Sfile Sets the mail statistics file to the file. Statistics are only collected if the file exists. This file must be created by the user. s Enqueues before delivery, even when in immediate delivery mode. Ttime Sets the timeout on messages in the queue to the specified time. After this interval, sendmail returns the message to the sender. The default is three days. uN Sets the default user ID to use when calling mailers to the value specified by N. v Run in verbose mode. xlavg When the system load average exceeds lavg, queue messages instead of sending them. The default value is 8. Xlavg When the system load average exceeds lavg, incoming SMTP connections are refused. The default value is 12. Processed February 11, 1993 SENDMAIL.CF(5,F) 6 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) yfactor factor is added to the priority of the message once for each recipient (lowering the priority of the message). Messages with many recipients are thus penalized. The default value is 1000. Y The sendmail program delivers each message in the mail queue from a separate process. This option is not required and may increase overhead in the AIX environment. zfactor factor is multiplied by the message class (determined by the Precedence: field in the header and the P lines in the configuration file) and subtracted from the message priority. Thus, messages with higher Precedence: values are favored. Zfactor factor is added to the message priority every time a message is processed, decreasing its priority. In most situations, factor should be positive, since hosts that are down are usually down for a long time. The default value is 9000. Pname=num Defines values for the Precedence: field. When name is found in a Precedence: field, the message class is set to num. Higher numbers indicate higher precedence. Negative numbers indicate that error messages are not returned. The default num is 0. The precedence of mail is defined by a header of that name within the mail. Rlhs rhs comments Defines a rewriting rule. One or more tab characters separate the three fields of this command. If space characters are to be used, the configuration option I must be set. The fields may contain embedded spaces, unless the I option is set. If the I option is set, the embedded spaces must be represented by the character defined in I. After the fields are separated, the character representing the space is changed to an actual space. Sx Begins the definition of a rule set. If a rule set definition is begun more than once, the new definition overwrites the old one. Tuser1 user2... Defines system administrative (trusted) user IDs. These IDs have permission to override the sender address using the -f flag. There may be more than one ID specified per line. SPECIAL MACROS Macros are interpolated using the construct $x, where x is the name of the macro to be interpolated. Lowercase letters are reserved to have special semantics, used to pass information in or out of the sendmail program. The following macros must be defined to transmit information into the sendmail program. Processed February 11, 1993 SENDMAIL.CF(5,F) 7 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) e The SMTP entry message. This message is sent by the SMTP handler in the sendmail domain when the host connects to it. j The official domain name for the site. This must be the first word in the $e macro. The domain name is a sequence of domain element strings, ordered from the most specific to the most general, separated by periods. The use of nicknames or aliases is not allowed. The maximum domain name length is 64 characters. The $j macro should use this format. l The format of the AIX "From" line. This macro is usually a constant. n The name of the daemon (for error messages). This macro is usually a constant. o The set of operators in addresses. This macro consists of a list of characters considered to be tokens and separates tokens during parsing. For example, if r exists in the $o macro, the input, "address", parses into three tokens: "add, r," and "ess". There are many internal hard-coded delimiters added to this list by sendmail. It is recommended that this list not be changed. q The default format of the sender address. Sendmail defines some macros for interpolation into argument variables for mailers or for other contexts. These macros are: a The origination date in Arpanet form. $a contains the time extracted from the "Date" line of the message (if there is one). If the incoming message has no "Date:" line, the $a macro contains the current time. b The current date in Arpanet form. $b equals the current date and time (used for postmarks). c The hop count. The hop count is the number of times the message has been processed. The -h flag of the command line or the number of "Received:" headers in the message determine the hop count. d The date in AIX (ctime) format. f The sender (from) address. The $f macro is the sender address as seen from the current host. g The sender address relative to the receiver. When mailing to a specific host, the $g macro contains the address of the sender relative to the receiver. For example, if the user, "newton", at system, "appletree", sends a message to "chopin@piano", the $f macro equals "newton" and the $g macro equals "newton@appletree". h The receiving host. i The queue ID of the host. The $i macro is useful for tracking messages Processed February 11, 1993 SENDMAIL.CF(5,F) 8 SENDMAIL.CF(5,F) AIX Technical Reference SENDMAIL.CF(5,F) if put into the message ID line. p The process ID of sendmail. $p and $t are used to create unique strings for the "Message_ID" field. r Protocol used to talk to sender. s The host name of the sender. t A numeric representation of the current time. The macros, $p and $t, are used to create unique strings for the "Message_ID" field. u The receiving user v The version number of the sendmail program. The $v macro can be found in "Received:" header messages and is useful for debugging. w The hostname of the local site and, if present, the address. x The full name of the sender. The name is determined by one of the following: the full name passed as a flag to sendmail, the value found in the "Full_Name" line of the header, the value found in the comment field of a "From" line, or if the message originates locally, the full name found in /etc/passwd. y The terminal ID of the sender. z The home directory of the receiver. FILES /usr/adm/sendmail/sendmail.cf The sendmail configuration file. /usr/adm/sendmail/sendmail.cfDB The compiled version of the sendmail configuration file. RELATED INFORMATION The sendmail command in AIX Operating System Commands Reference. Processed February 11, 1993 SENDMAIL.CF(5,F) 9 MAI k4$# ++ꯄ-# ./usr/man/cat8/snmpt.8c.ds BD /etc/snmp/ .ds ED /etc/snmp/ .ds ID /usr/lib/ .ds LD /etc/snmp/tmp/ .ds SD /etc/snmp/ .TH SNMPT 8c "21 Jun 1990" .\" $Header: /f/osi/snmp/RCS/snmpt.8c,v 7.2 90/08/29 15:04:15 mrose Exp $ .\" .\" Contributed by NYSERNet Inc. This work was partially supported by the .\" U.S. Defense Advanced Research Projects Agency and the Rome Air Development .\" Center of the U.S. Air Force Systems Command under contract number .\" F30602-88-C-0016. .\" .\" .\" $Log: snmpt.8c,v $ .\" Revision 7.2 90/08/29 15:04:15 mrose .\" doc .\" .\" Revision 7.1 90/06/23 17:02:01 mrose .\" update .\" .\" Revision 7.0 90/06/21 20:35:54 mrose .\" *** empty log message *** .\" .SH NAME snmpt \- SNMP trap sink .SH SYNOPSIS .in +.5i .ti -.5i .B \*(SDsnmpt \%[\-t] \%[\-x] \%[\-z] \%[-p portno] \%[\-a x121address] \%[\-i\ pid] \%[\-f\ audit-file] .in -.5i (under /etc/rc.local) .SH DESCRIPTION The \fIsnmpt\fR server acts as a trap sink. Unon receipt of a message, it simply logs it to an audit-file. .SH TRANSPORTS For a UDP\-based network service, the server listens on port 162 for SNMP messages. The `\-p' option overrides the default UDP port. .PP For an X.25\-based network service, the server implements the transport class 0 protocol, decodes the connection request packet, and execs the appropriate program to enter the protocol and provide the service. The `\-a' switch is used to specify the X.121 address of the local host \(em this overrides the entry in the \fBisotailor\fP file. In addition, the `\-i' switch is used to specify the protocol ID to listen on \(em the default is 03019000. Note that on most X.25 implementations, if the local X.121 address is not present in the \fBisotailor\fR file, then the `-a' switch must be used in order for the server to receive incoming calls. .PP For a TP4\-based transport service, the server simply listens to any incoming connections for selector \*(lqsnmp-trap\*(rq. .PP By default, all network services are enabled (if defined in the configuration). The `\-t' option specifies TCP\-only operation, the `\-x' option specifies X.25\-only operation, and the `\-z' option specifies TP4\-only operation. .SH "DEBUG OPERATION" If \fIsnmpt\fR is started interactively, or if the `\-d' switch is given, then debug mode is entered. In this case, all logging activity is displayed on the user's terminal. In addition, the logging information is more verbose. .SH FILES .nf .ta \w'\*(LDsnmp.traps 'u \*(LDsnmpt.log log file \*(LDsnmp.traps trap file /etc/snmpt.pid daemon PID file .re .fi .SH "SEE ALSO" RFCs 1155, 1156, and 1157. .SH AUTHOR Marshall T. Rose, PSI Inc. This work was partially supported by the U.S. Defense Advanced Research Projects Agency and the Rome Air Development Center of the U.S. Air Force Systems Command under contract number F30602-88-C-0016. .PP Although this package is distributed with the ISODE, it is not an OSI program, per se. Inasmuch as the continued survival of the Internet hinges on all nodes becoming network manageable, this package was developed using the ISODE and is being freely distributed with releases of Berkeley UNIX. .PP It must be stressed that this package is not a complete network management system. In particular, whilst \fIsnmpd\fR provides a minimal agent functionality, there are no Network Operation Center (NOC) tools--\fIsnmpi\fR is a debugging aid only. ". h k!$+\+ꯄ-./usr/man/man8/sliplogin.85.\" Copyright (c) 1990 The Regents of the University of California. .\" All rights reserved. .\" Copyright (c) 1993 IBM .\" .\" Redistribution and use in source and binary forms are permitted provided .\" that: (1) source distributions retain this entire copyright notice and .\" comment, and (2) distributions including binaries display the following .\" acknowledgement: ``This product includes software developed by the .\" University of California, Berkeley and its contributors'' in the .\" documentation or other materials provided with the distribution and in .\" all advertising materials mentioning features or use of this software. .\" Neither the name of the University nor the names of its contributors may .\" be used to endorse or promote products derived from this software without .\" specific prior written permission. .\" THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED .\" WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF .\" MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. .\" .\" @(#)sliplogin.8 5.2 (Berkeley) 7/1/90 .\" .TH SLIPLOGIN 8 "March 16, 1993" .SH NAME sliplogin \- attach a serial line network interface .SH SYNOPSIS .B sliplogin [-cia] [-p .I loginname ] [-t .I ttyname ] [-b .I baudrate ] [-h .I localhost ] [-r .I remotehost ] [-m .I mtu ] [-n .I netmask ] [-d .I dialstring ] .SH DESCRIPTION .B sliplogin is used to turn the terminal line on standard input into a Serial Line IP (SLIP) link to a remote host. To do this, the program searches the file .B /etc/slip.hosts for an entry matching .I loginname (which defaults to the current login name if omitted). If a matching entry is found, the line is configured appropriately for slip (8-bit transparent i/o) and converted to SLIP line discipline. A shell script is then invoked to initialize the slip interface with the appropriate local and remote IP address, netmask, etc. .PP The usual initialization script is .B /etc/slip.login but, if particular hosts need special initialization, the file .BI /etc/slip.login. loginname will be executed instead if it exists. The script is invoked with the parameters .TP .I slipunit The unit number of the slip interface assigned to this line. E.g., .B 0 for .BR sl0 . .TP .I speed The speed of the line. .TP .I args The arguments from the .B /etc/slip.hosts entry, in order starting with .IR loginname . .PP Only the super-user may attach a network interface. The interface is automatically detached when the other end hangs up or the .B sliplogin process dies. If the kernel slip module has been configured for it, all routes through that interface will also disappear at the same time. If there is other processing a site would like done on hangup, the file .B /etc/slip.logout or .BI /etc/slip.logout.loginname is executed if it exists. It is given the same arguments as the login script. .SS Format of /etc/slip.hosts Comments (lines starting with a `#') and blank lines are ignored. Other lines must start with a .I loginname but the remaining arguments can be whatever is appropriate for the .B slip.login file that will be executed for that name. Arguments are separated by white space and follow normal .BR sh (1) quoting conventions (however, .I loginname cannot be quoted). Usually, lines have the form .RS .I loginname local-addr remote-addr netmask mtu opt-args .RE where .I local-address and .I remote-address are the IP host names or addresses of the local and remote ends of the slip line and .I netmask is the appropriate IP netmask and .I mtu is the interface maximum transmission unit. These arguments are passed directly to .BR ifconfig (8). .I Opt-args are optional arguments used to configure the line. .PP It is also possible to use command line flags and arguments to specify the items found in the .B slip.hosts file. If present, command line arguments take precedence over values found in the file. .PP The options are as follows: .Tw Ds .TP Fl \-c Use TCP header compression. .TP Fl \-i Ignore ICMP packets. All ICMP packets will be discarded. .TP Fl \-a Autoenable TCP header compression if it is detected that the remote site is using it. .TP Fl \-p loginname Use loginname instead of the current login. .TP Fl \-t ttyname Open ttyname instead of the current terminal. .TP Fl \-b baudrate Set the baud rate to baudrate. .TP Fl \-h localhost Specify the IP address of the local host. .TP Fl \-r remotehost Specify the IP address of the remote host. .TP Fl \-m mtu Set the maximum packet size of the interface. .TP Fl \-n netmask Set an IP address netmask. Not required if address is not subnetted. .TP Fl \-d dialstring Specify a dialstring for remote slip connections. .SH EXAMPLE The normal use of .B sliplogin is to create a .B /etc/passwd entry for each legal, remote slip site with .B sliplogin as the shell for that entry. E.g., .RS Sfoo:ikhuy6:2010:1:slip line to foo:/tmp:/etc/sliplogin .RE (Our convention is to name the account used by remote host .I hostname as .IR Shostname .) Then an entry is added to .B slip.hosts that looks like: .RS Sfoo `hostname` foo netmask .RE where .I `hostname` will be evaluated by .B sh to the local host name and .I netmask is the local host IP netmask. .PP Note that .B sliplogin must be setuid to root and, while not a security hole, moral defectives can use it to place terminal lines in an unusable state and/or deny access to legitimate users of a remote slip line. To prevent this, a site can create a group, say .IR slip , that only the slip login accounts are put in then make sure that .B /etc/sliplogin is in group .I slip and mode 4550 (setuid root, only group .I slip can execute binary). .SH "DIAGNOSTICS" .B sliplogin logs various information to the system log daemon, .BR syslogd (8), with a facility code of .BR daemon . The messages are listed here, grouped by severity level. .SS Err Severity .TP .BI "ioctl (TCGETS): " reason A TCGETS .B ioctl to get the line parameters failed. .TP .BI "ioctl (TCSETS): " reason A TCSETS .B ioctl to set the line parameters failed. .TP .BI "/etc/slip.hosts: " reason The .B /etc/slip.hosts file could not be opened. .TP .BI "access denied for " user No entry for .I user was found in .BR /etc/slip.hosts . .SS Notice Severity .TP .BI "attaching slip unit " unit " for " loginname SLIP unit .I unit was successfully attached. .SH "SEE ALSO" .BR slattach (8), .BR syslogd (8) a kꒀ"mN+G+믄-./usr/bin/bs8/suG+ dhfHd @.textHHH .datad @d @dd@.bss#@#@hf.fkd800D".fkdc00ܴB.libȳH0@H0@Hܠ @H H+ HܮHؐÐUSVWhx @؃ V~ @;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tPh @hJ ؃ t:+'4d @fV*tƃ>uCÃFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u #@[C;p @'+[É=p @1uËp @p @L$ #@+fUS+;p @}4#@׃C;p @|p @[ÐUSVW+;p @}phV؃t } |BV#@@@P=؃t%#@@@PO׃#@@fpC;p @|_^[U=t @uأ$@t @$@Ð SVWt$ \$D$ i u+< u+1 )D )I; )D|$ D$$;D$ |ǃ t CF D$ ;D$$}>u_^[ Ég׋ET @RU RP]- @1 P- @jU4SVW]$@Ef)܃ u)@ x'A tC-u CE +uCEEEC5)܃ u)@ x'A  t* @]vE @FЉEE]E뢃.u^C5)܃ u)@ x'A  t) @]vE @FЉEE]EE+EteusC+t-u EËC5)܃ u)@ x'A  t k NЍ<}}؋EEE}}EE؉EEE?EE@EE t,E t EM]}}tEM]а uՃ}} Eu] EM]EmPuu؃ ]}}E]C$@E_^[Ð VWt$|$D$ D$fD$ ƋL$ϊ:uD+ t0D$ D$ D$L$ϊ:u D$ _^ ÃD$ D$D$ D$ _^ ËT$BD$ )DuD$D$D$ǀ8uT$ BD$  )DuD$ D$ D$ ƀ80+_^ U8SVWu؃Eu؃Eu ؃EE@P׃EЋE@P׃E̋E@P׃EȋE@Puu׃ E܋E@Pu u׃ E؋E@Puu׃ EԋE@PI׃E+;]}I+;u}+EЋM̋;u;u}$ǃMȋ F;u|֋ǃMЋ C;]|hEEP&zEEEPuu׃ uq׃uf׃u[׃uP׃E_^[fU SVW]uS؃E} ~E ;E~  @_^[ÃE E+E ;}E+E ƋE hVryEGC  uE_^[ÉU=-@}-@-@%@h3h,%@@׃+ÉU-@=-@}h4h,%@׃-@M %@UHSVW] }EEEE';)u -@ -@h,%@׃E t u=)EEE;t uB uE$@  =$@ h)h,%@L׃_^[ÍEE+$@$@Eԣ$@^u$@E  ;]rh2h,%@׃EE*t\u E{t];u C_^[Ëƃ[| j@tt6t\ th<( CP=$@uEC$@_^[h$h,%@8׃}f EW EH EE;tE $ CC CE$@EE^uEEC0 tuh1h,%@׃[vEE@tt!Hh1h,%@H׃E}}PEEME L]t3 uh1h,%@׃;uuh1h,%@׃}|EDEZEż @PE4Ÿ @EP׃ u1C\CM ; @CM ; @E܋E܃<Ÿ @uE܃<Ÿ @h1h,%@P׃EEt uh1h,%@%׃CP=-@t CΈ+-@5-@-@% u%-@=-@-@% u%-@=-@-@% u%-@=-@-@%C t-@-@ -@%C t-@-@ -@%C t-@-@ -@% t-@-@ -@؋EE=th1h,%@׃EE]8h1h,%@׃!CTEE.Kt uh1h,%@s׃=-@t CΈ+-@5-@-@% u%-@=-@-@% u%-@=-@-@% u%-@=-@-@%C t-@-@ -@%C t-@-@ -@%C t-@-@ -@% t-@-@ -@EE]th1h,%@#׃CXE[-uIE@;sAE]t6];$@rEȊ HEE;$@s硘$@`C:$@C=-@t CΈ+-@5-@-@% u%-@=-@-@% u%-@=-@-@% u%-@=-@-@%C t-@-@ -@%C t-@-@ -@%C t-@-@ -@% t-@-@ -@؋EE]+E~h2h,%@T׃3+EM$EEtt]=$@ |h+h,%@׃EE $@CC $@$@E;Es$@$@;$@th*h,%@׃CCEM E`}EEEEE0r9wkE ƃЉEhh,%@(׃EE\t,u}~h h,%@׃CM܈,u=EE th,h,%@׃EE\uC EIEE}th-h,%@׃}u CM܈_C%K;Dh.h,%@N׃-h$h,%@7׃ e1\9S;urhh,%@׃C$=-@t CΈ+-@5-@-@% u%-@=-@-@% u%-@=-@-@% u%-@=-@-@%C t-@-@ -@%C t-@-@ -@%C t-@-@ -@% t-@-@ -@]C=-@t CΈ+-@5-@-@% u%-@=-@-@% u%-@=-@-@% u%-@=-@-@%C t-@-@ -@%C t-@-@ -@%C t-@-@ -@% t-@-@ -@ذ u_^[USVWu ]%@h,%@׃ t =%@+_^[-@VS3_^[fUSVW]u %@h,%@[׃E tE죌%@+_^[-@=$@t$@VS_^[Ã=-@tqut4t,VS t _^[;w+_^[+_^[ð _^[ÐS\$C%$@u N%+$@$@[VWT$ t$|$ǃ tBF:t+_^ø_^ÉU4SVWE+E  u+_^[ËE EЃ=-@tE E ؉E';)tE   tE EԸ)@Pu EP׃ E }h<h,%@׃Eԣ)܃ u)5)@׃@ 'A }+EPE PS׃ }h<h,%@f׃EE E@ EEEEE +EЋM;uP EEffR ffff EEffftf=-@tEEE';)tE  tEE)@PuEPD׃ E }h<h,%@=׃EEE)܃ u)5)׃@ 'AEfE@'MA# $E҃=-@tEEE';)tE  tEE)@PuEP\׃ E }h<h,%@U׃E)܃ u)5)׃@ 'AE }UEPEPu*׃ E }h<h,%@׃EEXh<h,%@׃EEEE=-@tEEE';)tE  tEE)@PuEPA׃ E }h<h,%@:׃E)܃ u)5)׃@ 'AE }.EPEPu׃ E }4h<h,%@׃ EEEEh<h,%@׃EEffftf=-@tEE';)tE  tEE)@PuEP׃ E }h<h,%@׃EEE)܃ u)5)׃@ 'FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t&hh<@h-@SSh<@׃h-@uX t_5$@A%@$@+ËWShGPzO-@P׃ -@8ƃ $@+E_^[+_^[fUh @3LÐUh*=h*}hd*h ׃d*d*ܱ 6Ph׃=B@thhB@T׃h|@|@` PoSh4=@v*P&׃<=@%0u h!׃h4=@V*P׃<=@%0u h׃5@h*׃5B@׃hD*׃h@h@>׃B@h5B@ ׃=0=@t50=@׃0=@UfTC@f@f=@1@@p@@hhB@ÉU5@vJU=@t5@]J5@MJfUh`C@׃0M@@E@E @h=@׃5=@׃d*ܣ\C@}~Rh@E p׃B@=B@u&E p5@h*׃ hP׃f=@0D*ܣB@f=@1hB@׃h@h@hhh@hLh@h@h?hh@hLh@h@h@hh@hLhh׃t6Ph׃7Ph{׃7Ph h׃LF@=0=@t TC@PC@TC@PC@Eh@׃5B@+EPELD@P[׃ tXhLD@׃ELD@\u f@ELD@XC@=@0uz{@D*;B@tI5B@׃=0=@t0=@B@0=@"D*ܣB@f=@1 h-ÐUSVWTC@=TC@uThh@hLD@׃ u9hh@LD@EhLD@׃MȃQ׃ XC@ t XC@ uXC@ޡXC@ dXC@ TXC@#CXC@#2XC@EPh( tQXC@ t XC@ uXC@ދXC@XC@:u5@EP)XC@0M@.p;@s5@&f5@@@0@=TC@@@8@XC@ t XC@  uXC@# u5@%@TC@f@_^[USV@E=@u @@XC@!u%XC@5XC@h @׃^[áXC@#m>@@f@@EXC@ t XC@  uXC@# u h@%+@@0@h|@h>@,؃}@tt@thS8F8tZ5\C@S$FP׃\C@@x}5\C@h ׃\C@ 5\C@׃TC@=@1uN=@0u>@;Ew0M@@^[ËE@^[ÐU׉E u@hh/׃huh"@h&@h*@׃h׃Ã}u5(@#hh׃h@V׃6PhfUSVW=XC@EEP$ uhA_^[h@EPS%u=XC@h_^[f5p@ff f=*$\@@ @&hE&fEf@@@MЉ@f@f@ @@ @XC@ t XC@ uXC@ޡXC@ t XC@  uXC@# f@@@ @f@@< @&t@< @=t5@@!@@EE%fEf@@@M̉@@ 5p@ @f@f@ @@ @E @5p@=u@ @=:fXC@ t XC@ uXC@ޡXC@iXC@@fXC@@f@@< @&t0@< @8t@< @=t5X@^ @@ @@< @=t@< @=u0@< @&d@< @=LXC@ t XC@ uXC@ޡXC@f XC@@i XC@EP  tdE$fEf@@@Mȉ@hEP7"Eċ@@Mĉ@* h2@!@p5p@EP׃ EPhh`C@׃XC@ t XC@ uXC@5XC@sٽlfhflf fh٭h۝d٭ld$@XC@ ttt5@T5p@.u  @8 @- h,  uhh5p@Ef@@@M@ E)fEf@@@M@ @ @2f@f@ @ @hk rXC@EhQ XC@,XC@E%fEf@@@M@@@E@ @2f@f@ @ @XC@E@Eh E@XC@,ulXC@h E @XC@EEXC@h_ EXC@^@t&@t@t5@E%fEf@@@M@@@EXC@E@ @2f@f@ @ @EXC@huEXC@E<fEf@@@M@E @XC@EEXC@hEXC@h" E fEf@@@M@E&fEf@@@M@@ @@ @f@f@ @7XC@ t XC@ uXC@ޡXC@ t XC@  uXC@# '@f@@< @7t5@@@EE%fEf@@@M@@@f@ @ @E @~@ |\f< @7uFE#fEf@@@M@@@ @ }  5@@ |Y< @2uFE%fEf@@@M@@@ @ } wEP u5@g5@EP9E!fEf@@@M@@@@@E@fXC@ t XC@ uXC@+LF@؋XC@XC@8<(IfEP tthEPLF@LF@kD@P׃ CÐXC@ t XC@ uXC@ޡXC@,uXC@덡XC@)XC@XC@ t XC@  uXC@# }EPI lhEPLF@LF@kD@P׃ XC@ t XC@ uXC@ޡXC@,u XC@NI=LF@ EE LF@OEfEf@@@M@E@@M@E(fEf@@@M@@ @LF@EfEf@@@M@EP tFhh7EPW6׃}@@M@/E@@M@EP^ thEPDž|f|f@@@|@x@@x@zDžt@@t@f=@tf@=@P׃h|@h0M@=@t5@׃@Džpfpf@@@p@k8TC@PC@=0=@t5@D*;B@t B@0=@>@@f=@0TC@hQ h|@h>@P4Eu ׃@PV׃@u5@ֿ׃h4@5@踶׃B@=B@u1D*ܣB@5@ȶ׃@5@>@5p@0uA7>@;@w 0M@@hhB@耹׃5p@;u50@@0M@;@w0M@.p;@s0M@@ f=@1+_^[ÉUSVW@EuKXC@= XC@@E@t @uu@@Eh}uf5@@@0@}@@8@@u_@E@h f@@@@uuXC@5H@E;@_^[fUuZEXC@h<E==@t XC@_tԃ}thufUSuE==@XC@&u EXC@|uE}tkXC@XC@&t XC@|uXC@h@]f@@@@E==@e[ÉUSVWEuh==@E Eh;}f=@@@8@kE t(f5@@@0@똃EEE t(f@@@@_^[ËXC@XC@fftift+ftDfupXC@=u XC@ øáXC@=u XC@ ø áXC@=u XC@áXC@=u XC@ÃXC@+ÉUSVu==@fXC@+uIXC@@+t;XC@h f5@@@0@TXC@-uTXC@@-tFXC@h; f@@@@==@I^[ÐUSVWu==@XC@*u>XC@hf=@@@8@XC@/u;XC@hf5@@@0@FXC@%uFXC@h<f@@@@==@_^[ÐUSuX==@tHXC@^u;XC@h.f@@@@[USVXC@ t XC@ uXC@ޡXC@?~XC@*f5@@@0@@@EhG+f@@@@E @^[u^[USXC@ t XC@ uXC@މXC@-uXC@@-u XC@!uVXC@-uEXC@h]f@@@@[u[USVWE=@XC@ t XC@ uXC@ޡXC@#uXC@XC@ tXC@ t XC@#u} XC@(1XC@h)[؃XC@ t XC@ uXC@ދXC@XC@[t h6@ hXC@ t XC@ uXC@ދXC@XC@]t h8@E,fEf@@@M̉@]ȋ@@Mȉ@=@XC@ tXC@ XC@ڡXC@)܃ u)@ x'A uXC@.= @ u5XC@貫 5XC@5 @\ xۅx]XC@;$@B$@XC@@]@]Eٽxftfxf ft٭t۝p٭xEڝpuzEfEf@@@Mĉ@Eٽlfhflf fh٭h۝d٭ldWEfEf@@@M@+ۃtkCÃ|XC@"EfEf@@@M@hh(EEXC@XC@"XC@ tXC@ t XC@#u5`@볡XC@\u`XC@XC@fftKft ftft(fu,t/XC@ %XC@XC@ XC@ XC@EE XC@ 1EEEhu.׃P'Euu׃u!׃EE@@M@XC@oXC@+uXC@@+uXC@E)XC@-uXC@@-uXC@EEP u}u }5x@gh@EPt5@CXC@ t XC@ uXC@ޡXC@(XC@h)h@EP4}@ |;u F;~5@E"fEf@@@M@=h@E@@M@]@@M@h@EP\tRVE-fEf@@@M@@@ @YE fEf@@@M@]@@M@hEPXE@@M@+ۉXC@[u9XC@h]؉XC@ t XC@ uXC@ EfEf@@@M@]@@M@EPk't5@EPDE@@M@EP'؃tPEfEf@@@M@]@@M@ZEfEf@@@M@EPE@@M@}}u<:|f@@@|@_^[ÐfD$f@@@L$@É@@L$@ÐUf=@tf@h@P׃=@0u 0M@@LD@ XC@+ȃP~+|LD@[E5ExELD@ u  x |EELD@;XC@rEƄ|=TC@tD=@t"5@h:@h*׃ @5TC@5@h*ܢ׃ |PhLD@uh@@h*転׃=TC@tf@hh@ҥ׃ÐS\$XC@ t XC@ uXC@ޡXC@)܃ u)@ x'A  u+[D$(|$}C XC@XC@ XC@D$XC@)܃ u)@ x'A u[ÉUSV]u E$hS6觪׃ uE^[Eƃ>uظ^[f T$+fB$ t><$0|<$9 $ЉD$<$a| <$f$ D$L$D$뵃£$@ ÐUSVu ]E}dhEk TF@PSߩ׃ u: tEk <PF@t5@ t Ek 4PF@E^[ËEk <TF@u0hSEk TF@P׃ Ek 4PF@E^[E}dY5@J^[fUSV]E,u|hF PS ׃ u^[E@;Ef@f@P5hSF PϨ׃ FFF ^[fUS]Ù=@f@Ù=@U@|5 @@u3f=,M@t+_^[hWS6'׃_^[ËEVЋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u_^[ËEM UE;E5h@_^[fUSVW]u =LF@u f=@t5@ÃE -$@ƍ K@_^[à EEE˃ }|FT ƋÃF= ƋÃF& ơ@˃k HM ƋÃEE@ t E@us;}uuuv6s'H@]u @@H@]s0E}fEfEf fEm]mE] t6E}fEfEf fEm]muv6t uuv6'k ++EE"kE QP׃EEE;~huEE1fkE QFEE8tGME EE;~˃EF" VV EEF@˃k HM@E@ E0׃ÃEEf@f ftftvE0ڕ׃gbE0V;P訕׃E@WE@x}E0h ׃E ENHFu]@; =@u@=@EAEEh6 ׃PM6E0؝׃ ENHE@ shB@՛׃ tM5B@VB@E B@B@@B@ 'hȓ׃E B@;uB@@B@k PF@B@ 5@@l@P׃ tT@ph5@T@@hE FF@@d@@@N@ @Hd@˃ @M Hh"@F?FÃE̋ÃE}uẼEk +E@u9}t5@VPE0,EEEE;EE@ u5@qE@~kE QQ}fEfEf fEm]mEE}5@uu] EEE;Et}kE ȋƇ񗥥?V}fEfEf fEm]mEE;}}}5@ k +kE ȋƇ񗥥k Vz E}tu H A k PF@ - hV@(  =@t5@/׃VP蠐׃u |@` L;s5(@ ÃTC@ ƉEЃ@@Ep@ ;Ew@5@@ Ek +щPEM HE˃ H EKE Hk PF@Ã8!5X@׃u5p@f׃hhXC@5B@h5XC@׃ hhEأ@FPuu׃E˃ MHE˃ MH E@ ;E~5@f @kM pEE,@@ ;EFFE ƃE E;E|͋EЉE f=@ 5@| ƍ K@Fu-h6 ׃P K@65K@׃@pV[@@@E @pK@Ζf=@t7f@V9 Pp@ @+ȋ=<@Ph`@脓׃ @p@;@ hl@ K@;@t5@h@Pc׃K@K@K@u ÃEV $UF|ÃEÃẼk +E RI$P@׉EE]E54@]܋E܉EFFV Ep@;@u6E;@}}}5@E @F@@ ;E|̓}|ǃE@kM HƇ񗥥p@;@u@ @@ EEFaFPA PF P4 PF @ uF ,@$V Pu ;+ff@V XC@hh Eأ@FPuu.׃f@F PB PV P蛈׃ u+EEFmh4=@VK Px׃uFF;<=@%0E%@ tt@BE% tv@.E% tx@E%` tz@|@FK@ΖFPRPF PEPVP FF PcPVYPԸEEFSVEU} KE;$@E-@~@F F PPVP薌EEFFPPF PPVPM FVP׃EEFF pp0VWPhh@\EPK׃E؉F>Vu: @F!VP;EF P}fEfEf fEm]mEEExt5@EEuME@Ft5@EF Px}fEfEf fEm]mEEE;E=K@;@t5@h@P譋׃;@FEMDΖEMD K@F6f,M@F PEWu/Ef,M@F}t+EE{ K@FkfVf@RÃ8f=@t@P5@舌׃p@;@s55@l׃5@ @p@;@rEuE EEVP ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^  Ex E@~u0E Ph@hLD@ڎ׃ E0hLD@QE@uiEx EEHEMD8t2EMDPgPEMtWh@輊׃EE;E,E@ u u$PE Ph@耊׃ E@;E55@fEf@6_^[ÐT$Bu:u+Ë8t+X@t+ÐUSVW] ؋؋E0 th;^ u Ep_^[Ë~ tf@f@P!~G_ GG GEx_^[ËEEf @f@QM_^[fUS]f=@tf@h@P\׃S50@h*׃ =TC@t5TC@5H@h*׃ h@h*ۃ׃S[USVWu ]SČ׃<F PSh@SJ׃F uV%PSh@臈׃ F~u 6S~tv_^[ÐUSVW]C u_^[CPtgCQu\Cug3V׃<0= @ u VӂV5 @EEC u V׃;=$@t5`@rC_^[U S]C u S@}fEfEf fEm]mE[ÉU SVW]=@u+ @@@k*<@C =@ us3h@W車׃N}fEfEf fEm]mu=@u@@PWr׃ _^[W׃48.t0u_^[_^[CPt CQu x@_^[Ã;u _^[Ë_^[fUSVW]u CP蛄׃ tYtM@=@2 u @@<=@t@4=@׃@<=@_^[h@_^[fU SVW]uu GPt GQuZED*;Et!d*;Et*;Et u׃G!u EP=׃+G EEG}Gfftqftnft ft\!uVCP׃'p@]u D*܉ VS׃?u5@oGPwwh@]u d*܉@`@]u *܉%!uVCPk׃ VSD׃?tGQ5@GG _^[ÐUSp@@E}d}GEk PF@E}}EMk TF@E}|E}d|E^u$CPt CQuC PhCu 3~׃CCC E@;E0M@0M@@+TC@f@f@f@[ÉUS]EE;LF@}4hEkD@PS׃ uE[EE;LF@|̸[USVW]p@+ȋ=x@Ph@誂׃Ck TF@Ph@莂׃s+:f thd*h@s}׃k QPh@P׃GC ;hd*h@8}׃C>fC;}hd*h@}׃k QPh@׃GC ;hd*h@|׃_^[É T$D$$D$D$ ~ $L$$$ USVu ];w*F uFu 6|׃F ;v^[fUSV] SE}}}5@EE@;Et5@}t=@u5@ @}uH@@SYP׃ ~5@WV5@v׃@^[ËE!@q׃S菀׃PShɂ׃ E[ÐU EEE Eh$ uu] E%=u} uE% E  uEÍE%=u }uEÍE%=u@}u:EZ!@EEEEP  uXF"LE% E u8E^!@EEEEP  u F"EfU$SEEEEE EEEd!@]u]EEP[  h!@hhh!@o׃S~׃PSh׃ F"WEEP  u@h!@hhh!@o׃Sm~׃PSh觀׃ F!E[ÐU l!@]rh!@u u ËEEE Eh uu]T EfU t!@]rh!@u u ËEEE Eh u uu] EfU$SEEE EE%=Asuu[uu!@E "@EEEEPt huh:׃ h"@hhh"@n׃S|׃PSh׃ F"Tuu]uuf!@v*E&"@EEP u F"E[U,SEE܋E EE܃%=AsuuF[uu!@]!@]E*"@EEEEP0 huh}׃ h."@hhh>"@l׃S{׃PSh}׃ F"Iuu]!@]s*EF"@E؍EP u F"E[fU$SEEE Ehuu]BE%=tE[L"@]Eh"@EEEEP uUhuh|׃ hn"@hhh~"@k׃SMz׃PSh|׃ F!E[Ð $L$ $L$$ ÉD$fD$fD$fD$ÐD$ÐD$ÐD$fD$ÐD$D$ ÐD$fD$ÐUSVW"@]uE_^[Í}EEG%ff؋E%ff+E"@]v ++2~E_^[ÍEPE}$s׃ EMm_^[ÉUTSV#@]v#@]sEE #@]v#@]sEE8#@E̋EEЋE EԋEE؋EE #@] #@]u #@^[hEUM]"@v;EEEEP u F"E^["@]v;EEEEP u F"E^[E^[ #@]uME}fEfEf fEm]mċ] #@]sQ]E]uC #@^[E}fEfEf fEm]m]]E]EEEEP uUhuhx׃ h<#@hhhL#@yg׃VAv׃PVh{x׃ F!E^[hEM]KÙ="@ t E^[E^[ÉUEPu up׃ ]\#@]v\#@]t T#@m]EUEPu up׃ ]l#@]sl#@]t d#@E]EUEE?E]tEuuu u;#@rEu u5#@5#@UEUeÍD$L$ T$  ʉD$É+ÐD$D$-#@r=#@l$ËD$D$-#@r=#@<$fD$ff!$,$ËD$D$-#@r=#@<$fD$f $,$ËD$D$-#@r=#@<$fD$f$$f $,$ËD$D$-#@r=#@<$fD$f$$f $,$5#@s-#@Ã<$+f$Ã<$+f$Ã<$f$%?Ã<$f$%Ã<$f$% t@ @LANGC@(#)mb_tbls_init.c 1.5 AIX$@@C@(#)atof.c 1.5 AIXy|(&|(%|(U"Q (|(P$|(|(|(|(/|(A|(|(|(|(|(|(|(|(|(|(|(|( %P%|(|(|(|(|(|(|(|(|(|(Q (|(P$@(#)string.c 1.11 AIXRE error@ @(@0@8@B@J@R@Z@Wb@j@ alpha:]upper:]lower:]digit:]xdigit:]alnum:]space:]punct:]print:]graph:]cntrl:]-@&@&.@6@.J@R@'d@p@!%|@@9@@|G@@@@@@@ @@@"@*@L@T@X@`@n@v@~@@ @@V%@@E@@ @@ @@ @@ &@.@J@R@^@f@~@@@@@@o@@@@@@@@(@0@J@R@`@h@r@z@@@@@@@@@@@@@d @@p@$@2@:@ >@F@!\@d@"r@z@#@@$@@ @@%@@&@@ @ @ @$ @%8 @D @'j @r @( @ @) @ @* @ @+ @ @,!@ !@LvDMPPPPPPPP"JP%ICP?vDvDDPPPPCC>OPIE)NENNH@TLPNP@AICA2=q= X@@?'y,z|k{x{2||yyzz{{b||}}~a~jpWp6smmllllll0n0n0n0n0n0nwo5p#pIu~~qpjjj/k6skutxxttt uPw?x}rsftx@???etlcamnpfs@(#)bs.c 1.22 AIXr/dev/ttyrrgetwputwputerrbs exit!Invalid expression-csh/bin/sh?r??%s: %s %s%s^| <%.6s>No label%d: %.16s Returndcpbf%.6s%s[%s]=%s %.6s=%s %s[%d]%s=%s %.10f%lo%lxOut of string space%d: %.6s(, %.20s) , %.20s w@@@@@@@@@@@@@@@ @@@@$@(@,@4@<@B@J@P@V@&8=>$''()27436#?!9015;./@ @ D l̙L @@@@@@@@@0M@K@p@p@ \@`@f@l@r@z@@@@@@@@@@@@@@@@  ifelseeliffigotoexitqreturnfreturnfornextwhiledumptraceonintrrunclearbreakcontinuefunnufcompileexecutestopincludeibaseobaseeditargnargrandevalformatlastsubstrindextranssizeopencloseaccessftypematchmstringplottableitemkeyiskeyatanceilcosexpabsfloorlogsinsqrttplot -TXXXXXXXXXXXadt.cat ready adt.catFloating exceptionadt.catBad graph outputsystem.catPipe closedsystem.catCannot open %s system.catOut of code spacesystem.catInvalid expressionsystem.catCannot forkadt.catElse: no ifadt.catFi: no ifadt.cated %sadt.catibase/obase must be 8, 10, or 16adt.catForadt.catNext: no foradt.catNo foradt.catFunc def.adt.catNested `include'ssystem.catCannot open filesystem.catMissing filenameadt.catName Requiredadt.catUnbal. quoteadt.catExpressionadt.catReserved Name in Expressionadt.catArg. countadt.catSubscript on local nameadt.catSource line %d: adt.catDup. labeladt.catToo many labelsadt.catSymbol table overflowadt.catWrong delimiteradt.catTable too bigadt.catTable overflowadt.catOpen function, if, or foradt.cat name contextadt.catNo labeladt.catOnly single dim. tablesadt.catSubscriptadt.catSubscr. rangeadt.catRangeadt.catStack overadt.catRecursionadt.catUndefined function adt.catReturn: adt.catToo many argsadt.catArgadt.catTable: allocated nameadt.catarg not tableadt.catStatement: %d adt.catFunction stack: adt.catCompilersystem.cat%s - execution erroradt.cat in source line %dadt.catConversionsystem.catI/Osystem.catCannot access filesystem.catLast arg to open() must be r, w, or aadt.catIllegal graph functionadt.catgraph: arg countadt.catGraphic output never specifiedadt.catgraph: Bad dest.adt.catDot not implementedadt.catNo plot!@(#)atan.c 1.8 AIXatan2: DOMAIN error lib.cat@(#)exp.c 1.7 AIXexpexp@(#)log.c 1.14 AIXlog: SING error lib.catlog: DOMAIN error lib.catloglog10űA-DT!ICűA-DT!IC-DT!?@(#)sin.c 1.9 AIXsin: TLOSS error lib.catsincos: TLOSS error lib.catcos@(#)sqrt.c 1.11 AIXsqrt: DOMAIN error lib.cat@(#)fabs.c 1.5 AIX@(#)cwrap.c 1.3 AIX@(#)'src.com/lib/libm/fmod.c, bos, 130, 0012' 1.2 AIXqmDC~3@?@(#)pow.c 1.15 AIXpow: DOMAIN error lib.cat??@(#)floor.c 1.10 AIX0C@(#)copysign.c 1.4 AIX@(#)matherr.c 1.4 AIX/shlib/libc_s2 k=#mN++믄-./usr/bin/cflow# SCCSID(@(#)'src.com/cmd/cflow/cflow.sh, bos, 130, 0012' 1.2 AIX) /* Modified: 15:52:20 2/3/93 */ o= INVFLG= DFLAG= IFLAG= DIR=/usr/lib LINT1=/usr/lib/lint1 TMP=/usr/tmp/cf.$$ TMPG=$TMP.g CC_LINT_OPT='-E -C -Dlint' trap "rm -f $TMP.?; kill $$" 1 2 3 echo "" >$TMP.g base=`basename $0` case $base in cflow | cflow.sh) CC=cc;; *cflow*) CC=`echo $base | sed s/cflow/cc/p`;; *) CC=cc;; esac while [ "$1" != "" ] do case "$1" in -r) INVFLG=1 ;; -d*) DFLAG=$1 ;; -i*) IFLAG="$IFLAG $1" ;; -f) cat $2 >$TMPG shift ;; -g) TMPG=$2 if [ "$TMPG" = "" ] then TMPG=$TMP.g fi shift ;; -[IDU]) o="$o $1$2" shift ;; -[IDU]*) o="$o $1" ;; *.y) yacc $1 sed -e "/^# line/d" y.tab.c > $1.c $CC $CC_LINT_OPT $o $1.c | $LINT1 -H$TMP.j 2>/dev/null $1.c \ | $DIR/lpfx $IFLAG >>$TMPG rm y.tab.c $1.c ;; *.l) lex $1 sed -e "/^# line/d" lex.yy.c > $1.c $CC $CC_LINT_OPT $o $1.c | $LINT1 -H$TMP.j 2>/dev/null $1.c \ | $DIR/lpfx $IFLAG >>$TMPG rm lex.yy.c $1.c ;; *.c) $CC $CC_LINT_OPT $o $1 | $LINT1 -H$TMP.j 2>/dev/null $1 \ | $DIR/lpfx $IFLAG >>$TMPG ;; *.i) name=`basename $1 .c` $LINT1 -H$TMP.j 2>/dev/null <$1 $name.c \ | $DIR/lpfx $IFLAG >>$TMPG ;; *.s) a=`basename $1 .s` as -o $TMP.o $1 /usg/nm -he $TMP.o | sort -t'|' -n +1 -2 | $DIR/nmf $a ${a}.s >>$TMPG ;; *.o) a=`basename $1 .o` /usg/nm -he $1 | sort -t'|' -n +1 -2 | $DIR/nmf $a ${a}.o >>$TMPG ;; *) echo "`dspmsg -s 4 sh.cat 205 \"%1\\\$s -- cflow can't process - file skipped\" \"$1\"`" ;; esac shift done if [ "$INVFLG" != "" ] then grep "=" $TMPG >$TMP.q grep ":" $TMPG | $DIR/flip >>$TMP.q sort <$TMP.q >$TMPG rm $TMP.q fi $DIR/dag $DFLAG <$TMPG rm -f $TMP.? k$mtMT+g+쯄-tM./usr/bin/dbxwug+ W +HH@.textHHWH .dataH@H@HX@.bss\A\A +.fkd800D".fkdc00ܴB.lib\MH|(FH|(FH @H H+ HܮHؐÐUSVWh@؃ V@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tPh@hJ ؃ t:+'4H@fV*tƃ>uCÃFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u \A[C;@'+[É=@1uË@@L$ \A+fUS+;@}4\A׃C;@|@[ÐUSVW+;@}phV؃t } |BV\A@@P=؃t%\A@@PO׃\A@fpC;@|_^[U=@uأ$A@$AÐ SVWt$ \$D$ i u+< u+1 )D )I; )D|$ D$$;D$ |ǃ t CF D$ ;D$$}>u_^[ Ég׋ET @RU RP]- @% P- @jUSVW0APBBLBBB\B`BhBPB5LB=B=dBWhz@؃=hBuh{@؃[=hB}h{@؃CEEň@;hBtEE<ň@}ދE4ń@h{@G؃ƍ HB;rh {@_^[É>Í 0A񗥥$$@E<=hBB=hB}hB } hB=dB=Bh4{@؃=hBuhD{@؃]=hB}hR{@n؃EEfEň@;hBtEE<ň@}ދE4ń@hZ{@'؃hBE}|_}g}VE<@El4@;hBu:hBTB 0A}=`B`BH,@E=hBB=hB}蟽hB } hB=dB=Bh^{@M؃=hBuhn{@7؃Z=hB}h|{@؃BEEň@;hBtEE<ň@}ދE4ń@h{@؃!@EE8uE;xtEEE8| E;hBuE@E }+_^[Ã}h`B tt!tLh{@`BB;wl$$@E|/}g}&E<@HB8u$|@HBEȋ0AМ0A50AhHBpߜPr HB0hG0AhV~0AHB0AHBpHBphmF 0AHB0h;(0AHBPh;0A_HB0h>0AAhh>0A%5-BhPh>0AhhJ0AhNo0AHB0hQPHBph;Ph1- 0AHB0hPHBphPh1 0ACHB0hPHBpHBphPh  Ph1 0AhHB0hpPh1b 0Ahhh1A 0APz@0A1HB@0A50AhHB0P貚 Kݙ0A50AhHB0P耚 Lz@0ARLz@0ASLz@0APLz@0AQHB0AHB0HBph&Phc 0ApHB00AW=Lz@uTHB05-B5-B׃@PP׃PhPhc 0AuHB00AHB0HBphcPhcU 0AHB8u|@HBEȋ0A0AtHB0AcHB0AR0AChhPhhPhD 0AhhPHB0hD} 0AHB0HBphDW 0AHB0hD90AHB0hhPhD 0A`hhPhhPhE 0A#HB0HB0hE 0AHB0HBphE 0AHB0PhEY0AHB0h;0AHB0HBphPh  0A_HB0HBphPh  0A+HB0h0A HB HB HQh0AHB HB@;~HB HB@+EuhG0AHBphHBpءHBphY0AkhHBpHBpСHBphY0A7hhHBpHBphY0AHB0h0A5Bhs0AHB00AHB0HBph4 0AHB0HBph 0AfHB0HBph 0A@HB0h 0A"HB0h0AHB@0A0AHB0AHB8u|@HBEȋ0A0Az@z@0A0AHB0AohHB0h  0ALHB0HBph  0A&HB0HBph  0AHB0AHB0AHB0hh0A=Hz@t&= @t輂5z@h*x׃= @Hz@HBpHBpP=0AU @HB0HBph  0A%HB0HBp0AHB0HBp0AHB0HBpr0AHB0h L0AHBph -0AHB0HBp<0Ad= @ti5z@h*%׃詁HB00A%HB0AHB0h0A=Hz@t%= @th|@h*׃3= @Hz@HBpHBpPt0A @HB0HBph  0A\HB0{Ph"0A5HB0HBp0AHB0HBp0AHB0HBp0AHB0h \0AHBph =0AHB0HBphh 0AoHB0HBp&0ANHBpl-BP2 Dz@=Dz@t%HBp5-Bh4 0ApHBp5-B0AHB0AHB0AHB0h=0A= @t~h }@h*W׃~HB00AWHB0h 0A9HB0HBph 0AHB0HBph 0AHB0HBpho 0AHB0HBphI 0AHB0HBph# 0A{HB0HBph 0AUHB0HBph 0A/HB0HBph 0A HB0HBph 0AHB0HBph!e 0AHB0HBph? 0AHB0HBph 0AqHB0HBph# 0AKHB0HBph% 0A%HB0HBph' 0AHB0HBph) 0AHB0HBph+[ 0AHB0HBph+5 0AHB0HBph/ 0AgHB0HBph0 0AAHB0HBph- 0AHB0HBph- 0AHB0h0AHB@0AHB0AHB0h>0A=Hz@t%= @tzh$}@h*O׃z= @Hz@HBpHBpmP0A,HB0HBp0A HB0HBp0AHB0HBpy0AHB0h S0AHBph 40AHBp-BPp Dz@=Dz@t5z@蜜HBp5-B 0A%HB0HB0AHB0h0AHBPho0AHBp0hN 0AHB0h00AHB0h0AjHB0Ph0ACHB05,AhP0AHB0A?-B0A(A0AHB0yk0AHB0AHB0AHB0AHB0A_^[ÉUhƞ@hʞ@zn-B<7Ph5-Bn p8Ph5-Bwn 47Ph5-B^n \:Ph5-BEn :Ph5-B,n ;Ph5-Bn ;Ph5-Bm ;Ph5-Bm 8;Ph5-BmÉ+ҋfUS]C  $t@Cp;uԞ@ EȋPhޞ@ ׃ s;u@ EȋPh@׃ us;u@ EȋPh@׃ L;u@ EȋPh@׃&h @׃S)Ph(@f׃h*=h*}hd*h ׃[Ëd*d*ܱ [fUSVW]CuMs ;5|Bu*Sg)=@5@Wh.@׃ _^[S)A_^[S;5Bt ;5B~ uh4@ht5@6v FtuKt&@@$h>D _^[Ã@@p0hD _^[s5П@u_^[;5|Bu"@@PhT@׃_^[;5xBu1V thX@׃_^[h^@׃_^[Ã=lAu;5lBu @@0hd@׃_^[Ã=hAt @@0hj@a׃_^[Ã@@0hn@A׃_^[USVWEp8Ep E xVPhPWh SuhPh ؉s_^[USuɾ؃@@Es mE MA[f+Ð+ÐUu 腾@f+ÐUShuOP.hd@ChCE c% CEC [U5Bhhh@ -Bhh hn@ -Bhht@P輹-B=-Bu hx@Ms5Bhh@- -B,.B".B.B.B.BÐUShBoX@X@ECE C ECC5.BhSހPq  .BS[ÉUSVWE=.Bu+ .BEȋA  u+E u+C؋E;EE=.Bu+ .BEȋA X u+E u+FE;E'=-Bt!Ep5@׃hd*׃=-BExtE0h@5-B׃ ExtE@EpK-BEp褘-B=-Bu$uEp5-Bh@5-Bh׃(uEp5-B5-Bh@5-B>׃5.B u=.Bu+.BEȋA u+FP 5.B u=.Bu+.BEȋA u+CP =.Bu+ .BEȋA  u+E u+GE@;EuQEhu5.B u=.Bu+.BEȋA u+GP  =.Bu+ .BEȋAE}}u+ EEȋE}u+ EEȋAEE@;Eu]Ehu5.B}u=.Bu+$.BEȋA}u+ EEȋAPB~}]=.Bu+ .BEȋ u1-B=.Bu+ .BEȋ u -BE_^[fUSVW]{ uhʠ@h5@yn C C @8vC @xC p ;=-B>cuF @EFpu輙E.V芠@@E5-Bu茙E}uI3A u350@ ׃1l5H@h*׃Vh*GclsuuS(_^[;=-BuXV@@8shwS,A -B;HtwW'v tjs_^[;=-Bu-V莟sh@@0S_^[S%_^[S_^[S _^[ÐUSVW}w c u5,Aww h\ PShhfn PShvW_^[ÐUSVW}uh@h@5`@l +ۋE8uEpEŖTA EEMt  uf;t t W薸 ubu;]t}tuuE}u@>u@ EȋP;u@ EȋP5x@.k EEŔTA;E>_^[fUSVW=.Bu+ .BEȋA t3 u+ u+Cw;Eu+ uϋ_^[USV=.Bu+ .BEȋA t, u+ u+C؃~u Vs u^[USV=.Bu+ .BEȋA t- u+ u+C؃~u 6j u^[fU SVWE@ @EE@pun=.Bu+ .BEȋA t5 u+ u+C؃~u;~u 0 u_^[fUSVWEpԛ@@8=.Bu+ .BEȋA t7f u+ u+C؃~u;~u 0_ u_^[fU SVWu{ u 6,~u+ FEȋA u+~u+ FEȋAEȋ?^u"h"@׃whd*;$~u+ FEȋ~ h*@׃~u+ FEȋA tC u+ u+CWhd*  u h.@/׃ u~u+ FEȋ~ h2@׃v )h6@׃_^[Uuh8@ÉUSVW}?+G8Gp_ ;5-BuOC;,Ah>@׃C@ t5@k׃shd*"_^[;5-Bu hD@A׃Shd*_^[;5-Bt;5-Bu4hJ@׃@Shd*\@_^[hP@׃Whd*2_^[hX@׃Whd*_^[ÉUSVWu }hb؉;sEC=@t'}tE V-BV^-BEC C=-Bt5 u7V5@'׃ 7V5@׃ hd*螼׃5.BhSsPet _^[fUSV=.Bu+ .BEȋA txf u+ u+F3 u35آ@y׃5.B u=.Bu+.BEȋA u+FP*t u^[fUSVW+=.Bu+ .BEȋA  u+ u+FC;-BTz@Tz@ ~ =-Bt5-B05@׃ xt"0 u05@q׃s Ѹ=-Bt {uE{t:5.B u=.Bu+.BEȋA u+FPr =-Bt? t=-Bu u =`@t=-Bu5`@< hd*J׃_^[U SVW} u5 .Bu h _\@\@sEC-B}t)-B5.BhSqPq 5.BhSpPq 5-B;,Au \khzc t73hgPEuhWVE@=-Bt635 @蓾׃ _^[ÉUSVW+=.Bu+ .BEȋA tt u+ u+G;EuOhS5.B u=.Bu+.BEȋA u+GPp u =.Bu+ .BEȋAE}}u+ EEȋ؃}u+ EEȋAE;Eu[hS5.B}u=.Bu+$.BEȋA}u+ EEȋAPp }f uE_uh`@h*׃ =.Bu+ .BEȋ u1-B=.Bu+ .BEȋ u -B_^[ÐUS]=-Bt6358@萼׃{tC05P@w׃h@j׃} t'{t!CxtC0h@5-B8׃ [ÉUSVW=.Bu+ .BEȋA t5f u+ u+FC`@sI u΃=.Bu+ .BEȋA t4 u+ u+GC`@s uM`@_^[ÉUu5.B uu5.BUSVW5-BP;c}u+ EEȋA  u+ u+G{u+ CEȋAE}tv}u+ EEȋ}u+ EEȋAE>au<~tF8cu.} t5-B:5-Bn_^[Ã}u K+_^[USVW=.Bu k.BI=.Bu+ .BEȋA t) u+ u+F;Eu+ u =-Bt*h@¹׃uhd*h@襹׃hY؋EuٷCC E@@ C@C@5.BhSkPk {turC@_^[fUSVW}E @WwFW@+ƉE{t!s=.Bu+ .BEȋAE}t[f}u+ EEȋ؃}u+ EEȋAE{t3 u35@芲׃}u=.Bu+ .BEȋAE}}u+ EEȋ}u+ EEȋAEhVs5.B}u=.Bu+$.BEȋA}u+ EEȋAPd}t=.Bu+ .BEȋAE}}u+ EEȋ}u+ EEȋAEhV5.B}u=.Bu+$.BEȋA}u+ EEȋAPd}t=.Bu+ .BEȋAE}}u+ EEȋ}u+ EEȋAE u+ G EȋAE}}u+ EEȋE}u+ EEȋAEE8gu>w }u u+"G EȋA}u+ EEȋAPc}}'_^[ÉUSV=.Bu+ .BEȋA t( u+ u+Fs u^[USV=.Bu+ .BEȋA t( u+ u+Fs u^[USE @hXO؋E EC5.BhS aPa [ÉUhަ@h@:H0.BaPh50.BPH lPh50.B7H |_Ph50.BH rPh50.BH sPh50.BG sPh50.BG sPh50.BG sPh50.BG sPh50.BG uPh 50.BoG h@h@)G$.BaPh5$.B?G lPh5$.B&G |_Ph5$.B G rPh5$.BF sPh5$.BF sPh5$.BF sPh5$.BF sPh5$.BF sPh5$.BwF h@h@1F(.BaPh5(.BGF lPh5(.B.F |_Ph5(.BF rPh5(.BE sPh5(.BE sPh5(.BE sPh5(.BE sPh5(.BE sPh5(.BEÐUSVWu] VS;u ;5`.Bta;5X.BtY;5T.BtQ;5H.BtI;5P.BtA;5\.Bt9;5D.Bt1;5@.Bt);5|Bt!;5xBt;5Bt;5lBt Fus;`.Bta;X.BtY;T.BtQ;H.BtI;P.BtA;\.Bt9;D.Bt1;@.Bt);|Bt!;xBt;Bt;lBt Cu ;5<.Bt;58.Bt;5Bt;5Bu*;<.Bt;8.Bt;Bt;Bu Fu;lBt Cu Fu6v 衘;`.Bu#Cus 腘;|BuAFu6v b;D.Bu#Cus F;Bu+_^[fUhuÉUSVW]} ~h u h@ө׃ C $@C @u5@蚩׃$;u@ EȋPh@t׃s@@0h@N׃C @+[ ;\.Buh@O׃;`.Buh$@5׃;T.Buh6@׃;@.BuhJ@׃x;<.Buh\@׃a;8.Buhp@Ө׃J;L.Buh@輨׃35@)Lh@a׃u S C u h@5׃u Sku SSJ Nsh@׃9{ uS{ u5ī@Ju s S +u SS +;u@ EȋPh@聧׃SW++u s S h@S׃;u@ EȋPhʧ@/׃S+i+;uΧ@ EȋP5ܫ@׃@+;uا@ EȋP5@Ҧ׃SNPh@蹦׃ t7h*=h*}hd*h;׃d*d*ܱ; t:h*=h*}hd*h ՜׃_^[Ëd*d*ܱ _^[fUSVWu^ FuCu ,.B ,.Bu SV' Ct C>u@ EȋPh@躥׃+r uCuCu uu sV =Cu4C @uh@b׃C @u h@G׃[ th{ tbC ;X z_^[Ð;t?u[ >u@ EȋPh@׃=,.Bu h @ؤ׃_^[fUSVW} }uh@hM5 @UH uh.@hN5$@9H G =!4$|@WPE8uL@ EEȋP5<@G _^[uw uS _^[W% PhV@׃E@u_u  uPE8uZ@ EEȋ$uF$uFPhd@詣׃Vhh@虣׃hl@茣׃_ t>C  uhp@hg5T@ G EPSM[ uÃ}~h uh@,׃ h@׃_^[à uh@hq5l@F GEt}uh@٢׃_^[ËE@Ph@¢׃_^[uw W G @u h@蕢׃h@舢׃_^[uw W =,.B;h@Z׃_^[uw Wy h¨@9׃_^[WJ tuw WK _^[Whd*hƨ@׃_^[Ã?uȨ@ EȋPhҨ@ϡ׃_^[WPh֨@賡׃E@ueu uVE8uڨ@ EEȋhVh@r׃ uFPh@R׃Vh@B׃h@5׃_ t@;u@ EȋPh@׃{t h@׃[ uh@׃_^[à u'?u @ EȋP5@豠׃_W uC?u@ EȋFPw 苎PPh@a׃ uw W h$@C׃_^[GPh&@,׃_^[fUSh*=h*}hd*h(x׃d*d*ܱ(EX t>;u2@ EȋPh<@踟׃{t h@@襟׃[ uƒh*=h*}hd*h)׃d*d*ܱ)ExtNhD@Q׃EX tofCtCP5@BhS[ u[Ãh*=h*}hd*h k׃[Ëd*d*ܱ [ÐUSVW}Gd$@w _^[Ã= @t"h\z@p 50z@h2 m=dAt WYG"vGP5@AW诖)@WDPhF@=@t-Bd*P׃ #_^[W4 tAWCEw CuSuSuH_^[w _^[w 謋Cu:;`.Bt;X.Bu*WE)@5@uhL@V׃ W  #_^[Ã= @t"h \z@p 50z@h W"_^[;=xBuWWPw_^[;=|Bt;=`.Bt;=X.BuW@@PA_^[;=Bt;=<.Bt ;=8.B uhT@h35̬@@ GtuEt#@@$h% F@@p0h &s5@?WWP_^[w ؃@@0 u)hr@=@t-Bd*P詖׃_^[Cu.;`.Bt;X.BuG;4.BPV>_^[Vhx@=@t-Bd*PH׃ _^[Ã@@EWub_^[Ã@@0Vh~@ ׃_^[Ã@@0 uh@hd*ܕ׃_^[V&Vo;su@;u@ EȋPh@=@t-Bd*P聕׃ _^[Vh@=@t-Bd*PW׃ _^[G"vGP5@=W衒)@W6Ph@׃_^[USVWuk)@@Eh@=@t-Bd*PŔ׃EXS—CEsE=@=@;u@ EȋPh@=@t-Bd*PX׃ SE@[ uh@=@t2)h@=@t-Bd*P ׃H-Bd*P׃_^[ÐUSE@t tut@ĩ@ʩ@ u8؋[ÉUu u*USu虆؋CEEPEPu. E;E|E;E~/hЩ@5. u}t@5@K;@@M+MEMs xMM EH[f+Ð+ÐUSVu F؋^[f+ÐUSVW]hީ@=@t-Bd*P苒׃[;u@ EȋPh@=@t-Bd*PL׃ S胕 t9S蒌s AFu VWPVW s /[ uh@=@tC:s M@h@=@t-Bd*P译׃#-Bd*P蔑׃_^[ËT$D$ t;tOtu]t;T.Bu+;|Bt;`.Bu+;Bt;<.Bu+;Bt;8.Bu+fUSVW] uhz@h'5ذ@9  ;$ܯ@CE{ h@+ t6EpEwM;t:5@8_^[wEp s5@w8_^[ËCE{ CEh@+ tKEp蔍Ew膍EMquMȋE;tTh@ 8_^[w5BV Ep5B: h̲@7_^[Ã{| {?5 @7_^[Ã{{| {?qh@v7_^[Ã{UC8Cp u h@D7F t F  u F u F uh>u@ EȋPh@6_^[558@h*蠎׃sh*h&@h*~׃6_^[ËC8us譫CC8dCpF t F  u F u F t V t$>u(@ EȋPh2@6V>E>uV@ EȋPh`@5_^[SiS_^[S_^[ËC@@ tC@@  ub|4hn@h*9׃sh*葳hp@h*׃4_^[ËC8uCxu5P@5_^[ÉUSVW}_w uV{_^[Ã;t;cu3 t5h@4?RuS_^[S*_^[ t+>ct>u!?RuV_^[V_^[Ã;t;t;4t5@a4V_^[USVWEXx u5@24_^[Ã;t;cu0+35@h*׃Sh*A]3_^[Ã;t4;t/; t*2h@h*詋׃Sh*3>t>4uv>uuF@ t F@  u F@ u F@ t*c2h@h* ׃Sh*z2?t?cuWJ_^[W_^[USVEpX tG>t5>t0>t+15ȱ@h*變׃Vh*$2SB^[ t0;u S,^[ËE8Pu S^[S^[fUSVW] ;t0f15@h*"׃Sh*|1_^[sی { 27x t;u;~  uv$ u.+C8uȳ@ CEȋPhҳ@1Vd t+s u_^[ËC@t C@%u+CȋI ;uC@ @ uC@ C_^[ËC@ t C@  u C@ u C@ u*C8u@ CEȋPh@0_^[ÉUS] u5@0[Ã;ct&;t!5@[0Sh*ٮO[ÉUS] u5(@r0[Ã;th;ctc;t^; tY;tT;tO;tJSG u=G/5@@h*׃Sh*]h@h*׃g/[US] u+[sz;lBu[Ã;t ;t;u(s ts  [Ã; t;us[+[ÐUhP0B%P5t.Bq׃ 5t.Bhhh\0B6ffL$T$BAB ABA BABABABAB$A fU+҃ }M;LuBƒ |ÉUSVWh@5TNAo׃0B=0Bu5TNA5<@.50Bhh0h0Bb׃=x.Bt-.B.B.B.B_^[5t.Bhh\P ׃uPE f\f\\<$)hdĨ  uh@h5T@@. l.Bd.B.Bh.B\\<$)hs\Ĩ  uhζ@h5l@- l.Bd.B.Bh.B+L0B `XujCáL0Bk  l .BL0Bk L0Bk d .B.BL0Bk  h .BL0BCà {_^[ÉU50B蒃Uf=00Bt =x.Btuu uG hE @0B+TG;|VhdS5Ĺ@'=|0BtQh@)h @)S3h@)VF׃PV215x0B~׃_^[ÉUEE50B~׃E50B~׃MȋE=|0Bt'h*@2)h4@%)E0p+EEh}P觘MAU SVW50B肇׃@P΁׃50BWS׃h.Ww׃EtEhWCV4m tf;3u Ct[$ u u>Vkء-BC,A@ c % CcK0BCS@_^[U8SVW50BK}׃E50B7}׃50B&}׃50B}׃E+ۃ}50B|׃DCÃ|E50B|׃E50B|׃M ȉM50B|׃M ȉM50B|׃M ȉM؃=|0BhD@+'u(hT@'Vr(hd@&W\(5ܹ@&uC(ht@&hEP&h@&u)WH u}t EIhEP EukEu5@$ E@0BEE_^[ÐU0BEPÐU SVW50BK{׃E50B4{׃M=|0Bt*5 @5x0Bf{׃h@%S ( @+}50Bz׃D5Fƃ|E50Bz׃E50Bz׃M ȉM50Bz׃M ȉM50Bxz׃M ȉM50Bbz׃E50BNz׃M ȉM50B5z׃M ȉM50Bz׃M ȋ=|0BtLh@$hEP?,h@$u'hĸ@$W' _^[U SVW]S50By׃E50Bwy׃M ȉM50B^y׃M ȉM50BEy׃M ȋh{uԸ@ CEȋPy0BHQWhCu&{u޸@ CEȋPh@!=|0Bt h@w#0BHQ0._^[USV50Bx׃E50Byx׃M4=0Buk P|׃0B;50B~k P50B-~׃0B50B=|0BtB5$@5x0Bjx׃h@"50B %h"@5x0BFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t=|@0B 0B4W蝗0B 0B4Sr0B0B}ux0Bp  uh@h5@6 0B;0B uhD@h5@  Eء0B 0B4S0BE=0B_^[ÉUS50Bi׃E50Bi׃Mug=|0Bt$5@0hj@#Sr50BNi׃E50B7i׃Mt[ÉU(SVW50B i׃E50Bh׃E50Bh׃EEP EPE50Bh׃E50Bh׃M؍4=|0Bt`5@4uh @uyh@ua5@V:EP SK0BC tVS4C 3hA4C C;0Bu cK cK }u*@ EE؋ȋPp׃ u 0BC _^[ÍEP u 0BC _^[É{ _^[fU SVWzEup׃ 50B(g׃E50Bg׃MȉM50Bf׃E50Bf׃M4 };ƃE50Bf׃MȉM50Bf׃M4}tt50Bf׃E50Bwf׃M ȉM50B^f׃M ȉM50BEf׃M ȉM50B/f׃ E+QhufcK uR2C 0BC 0BCKƍljC~0B`H EC=|0Btfh4@MuhD@5VT}t2hT@u6hd@W`+ۋ_^[ÉUSVWuyn׃Eht@in׃MAQh׃؍5x@fuSn׃_^[ÉUSR؁cKCh1C hhCK[ÉUS/Pء0BC0BC [U SVW50BLd׃E50B8d׃M ȉM50Bd׃M ȉM50Bd׃M ȋhWR~P1Rء0BC0BC cKEC Vh~C=|0Bth|@WV_^[US}~$u u EPC+ۋ[fUDSVW50B?c׃E50B(c׃MȉM=|0Bt5@ t'#E50Bb׃E EE E}u/0BF0BF uk׃ to0B;0.Bu) t t ufNu-E fNhu|PVP0B0BF 50B=|0BtVh@ uh@ W}t5@ }t50@r  <3$|@50Ba׃E50Bza׃MȉM=|0Bth@ ub0B`H0B;0.Bu0B \.BH VE@t tu2t 0B 0BH .0B 0BH 0B 0BH 5H@ 0BE50Bu*MĉAF50B`׃E50B`׃MȉM50Bo`׃E50B[`׃M ȉM50BB`׃M ȉM50B)`׃M ȉM50B`׃E50B_׃M ȉM50B_׃M ȉM50B_׃M ȉMء0B`H0BEu,MĉA 0B@0BM܉H0BM؉H=|0B h@ uf h@ uN h@ u6  50B_׃E50B^׃MȉM0B`H0BEu5+MĉA =|0BY h@i u < 50B^׃E50B{^׃MȉM0B;0B uh@h5`@R 0B`H0BEu*MĉA =|0B h @u  50B]׃E50B]׃MȉM50B]׃E50B]׃MȉMܡ0B`H0BEu)MĉA 0BEu)MĉA0B@0B`0BM` H0BM` H0B@ u0B@ tz50B\׃E50B\׃M ȉM50B\׃M ȉM50B\׃M ȉMء0BEuhwMĉA=|0B h0@ uZ h@@uB 0B@ u0B@  hP@u  50B[׃E50B[׃M ȉM50B[׃M ȉM50B[׃M ȉM0B`H0BMH=|0B h`@u. 50B:[׃E50B#[׃MȉM0B`H0BEu]'MĉA =|0Bhp@ud50BZ׃E50BZ׃M ȉM50BZ׃M ȉM50BtZ׃M ȉM0B`H 0BMH=|0Bth@u0BE܃E܉Eă}u}PMĉAE܋@E܃}u~50BY׃E=|0Bth@quh@750BY׃E50BvY׃MȉM0BEuMĉ0B`H0BEDMĉA 0B@ 0B0B`H0B 0BH 0B 0BH0BMH=|0B~5x@u`50BX׃E50BX׃E50BX׃MȉMܡ0B`H0BEu$MĉA 0BMH=|0Bt0h@uOh@u'0BEE;Ef50BW׃E50BW׃E50BW׃M ȉM50BW׃M ȉM50BW׃M ȉM50B|W׃E50BhW׃M ȉM50BOW׃M ȉM50B6W׃M ȉM50B W׃E50B W׃M ȉM50BV׃M ȉM50BV׃M ȉMh5BhhhDCء0B@ C 0BC0BC }uCEЉCẺC0B;0B uh@hL5@Q Eԃ ||w$h@CCẺChCEЉCCRCCC;CEЉCC%CCC5@=|0Bt`h@Wuh @?u\h@'uDh*@u,E؋E;EB50B)U׃E50BU׃MȉMfNuY!F =|0Bh:@uc50BT׃E50BT׃MȉM0B`H0BEu MĉA =|0BhJ@u]50B9T׃E50B%T׃M ȉM50B T׃M ȉM50BS׃M ȉM0B`H0BMH=|0BthZ@su0BE܃:E܉Eă}u}P%MĉAE܋@E܃}u50BTS׃E50B=S׃MȉM50B'S׃E50BS׃MȉM0B`H0BEuJMĉA 0BEu1MĉA0B@0BH=|0BtAhj@Quhz@9uW5@=0Bt V50BDR׃E50B-R׃MȉM}_^[USVu u@.u V V+@؁cK0B@ @c % C0BC0BC ^[ËT$~ÐUDSVW+ۃ=|0Bt h@&E}50BKQ׃E50B4Q׃MȉM50BQ׃E50BQ׃E%EE=|0BtGh@u5@vuh@^WhujE ($@} uh@h'5@U  tu/50B,P׃E50BP׃MȉMe50BO׃E50BO׃M ȉM50BO׃M ȉM50BO׃M ȉMEuuC tu cKcKE܉CE%u KC=|0Bh@u8uuoC cKuSCEP50BN׃E50BN׃M ȉM50BN׃M ȉM50BN׃M ȉMԃ=|0Bth@!u>}EEă}u @ E܉EȋEVЋEċ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ x} uh@hz5@i +}ubu< ;Eu C t!C ;,AtC   uR[$ uIuH< t8f;Eu C t C ;0B u[$ u uE0h8@`0BCKuC }uK0BC C u0BC uhn@h5 @; + 1h@h58@ +h}u@ E܉EċȋPDfEu2;Eȃt3fEȋ;Eu E@ uEȋ@$Eȃ}u tgux؋Eȋ@EԉC0BCKuC }uK0BC RC uE0BC + }u@ E܉EċȋPh@50BJ׃E50BJ׃M ȉM50BJ׃M ȉM50BJ׃M ȉM܃=|0Bth@9uV5P@p"5h@`ǃP5@t=|0Bt h@ t&C;0Bus X t S;C E |KF$@cK%2cK#%cK$cK& cK'=0Bt SeEuR׃ #_^[ÉU0B0B==|0Bth@5x0BIUE tttu6t(0B0B60B0B*5@0.B0B5@0B 0BH50B!ÐUS50BH׃؃tnSd=|0Bt$5@<h@/S0B;0Bte50BHH׃؃u0B0B[ÐU8SVWEPV50BH׃E50BG׃M ȉM50BG׃M ȉM50BG׃u 50BG׃E=|0BtAh@SVh@=uh(@5x0BG׃EP}v u'}u*@ EEЋȋP5@'}EE;E0/EuNP׃+  uh4@h5@ huaEu 6 tGf;Eu6;{ u1C#t/Ct&SH uC%tCt[$ uE uNw 9@u(G;0BuE;EuN؋EX]4uhX@<"C uCKEX]EE;E=|0Bthr@5x0BF׃_^[ÐUS50BE׃E50BE׃Mug=|0Bt$5@ht@S^50B:E׃E50B#E׃Mt[ÉU0SVWEP250BD׃E50BD׃M ȉM50BD׃M ȉM50BD׃M ȋ=|0Bth@AV`EPEu'}u@ EE؋ȋP5(@McWM׃+50BD׃E50BD׃E50BC׃M ȉM50BC׃M ȉM50BC׃M ȉM܃=|0BtCh@Ruh@:uWh@5x0BC׃hW]Eu2 t+f;EuC ;EuCtC%t[$ u uWh@5NcKE% tW5@@ W5X@E%PCq_^[US50BB׃E50BzB׃MugW=|0Bt$5p@h@SI50B*B׃E50BB׃Mt[ÉU=0BuhF0B0Bd0Bh0BP50B =0Buh0B0Bd0Bh0BP50BUSE0B;0B|^0Bd0BP50BG׃0Bhh0B0BpPZ 0B;0B}0B 0B׃E50B>׃M ȉM50B>׃M ȉM50B>׃] 50B>׃E50Bo>׃M ȉM50BV>׃M ȉM50B=>׃M ȉM50B'>׃E50B>׃M ȉM50B=׃M ȉM50B=׃M ȋE=|0BtWh@ySh@cuh(@KWjh8@5x0B=׃y;}p0B;0B~=0Bd0BP50B%C׃0B=0Bu h:@#0B 0B<0B 0B؋50BF;50B0B@-^[Ë^[USVWuF @;0B uhl@h5@ F @ uh@h50@ F E]"EMѹ 󥗇EF ]+E@E fG "C؋E˖ѹ EC CttAtiWhl>u@ EȋP PCWhh>u@ EȋP PLCbWhl>u@ EȋP PCWhh>u@ EȋPm PCE@E}E_^[f|$|$|+ÉUSV]=D3Bu%h@vD3Bh@5D3Bv+Ë D3B<+Ë D3BEM| MU+Ë D3B`H+Ë D3B 0BH +Ë D3B 0BH+Ë D3BE MA +Ë D3Bp fN0BF 0BF+ÉF+Ë D3BE+QM+Ë D3B^[D$t tu#tH3BH3BH3BH3BfUSVW}W= tWL_^[Íw }Wh@n1B;} VG0B uء0BC 0BC0B_^[ÉU SVWEh@R8׃1B;0B4}t* tVCPh@8׃ VeE\ t>hCPh@7׃ VCPh@7׃ V蟙} tCPh$@7׃+Cá1B;Y uh1BPh,@v7׃ _^[ÐUSVW}  ||u 50Bh6@ jhu:LP fNhVhhh؉F ECFCECECE4_^[ÉU=p@50.BhhhZ@hh1B,L.B50.Bhhh`@hh1BT.B50.Bhhhf@hh1B\.B50.Bhhhj@hh1BH.B50.Bhhhz@hh1B|P.B50.Bhhh@hh1BP@.B50.Bhhh@hh1B$D.B50.Bhhh@hh1B`.B50.Bhhh@hh1B<.B50.Bhhh@hh1B8.B50.Bhhh@hh1BtX.Bp@US50Bhhu uh1B<؁cKEC [fUSVW}  ||u 50B5H@ _^[huSIEhhhhuhhuhhC 0BFCF1BufNEF 0BF_^[USV50Bhhu uh1B+؁KKcKEC huhhhCFFEF0BF^[ÐUSV=t@50Bhhh@hh1B0B50Bhhh@hh1B[0B50Bhhh@hh1B/0BH3Btk5@50Bhhh@hh1B`3B50Bhhh@hh1BT3B50Bhhh@hh1B\3B50Bhhh@hh1BWX3Bh5`3B5X3Bh@hpBh5`3B5X3Bh@htB50BhhVhh1Bhh@hShVhSe50Bhhh@hh1B`3B50Bhhh@hh1BY\3B50Bhhh @hh1B-X3B50Bhhh@hh1BP3B50Bhhh@hh1B`3B50Bhhh"@hh1BT3B50Bhhh(@hh1Bx\3B50Bhhh0@hh1BLX3B50Bhhh6@hh1B L3B5X3Bh>@h t@^[ÉUSVuhuODP.ء0BCcKE1BhSh hhC ء0BCshu h hhhChhD@C0BCCƙ=l@Chu h hhChhJ@gC0BCƙ=l@Cƙ=l@C^[U=x@50BhhhP@hh1B3B50BhhhZ@hh1B\|3B50Bhhhd@hh1B0x3B50Bhhhl@hh1Bl3B50Bhhhr@hh1Bh3B50Bhhhz@hh1Bt3B50Bhhh@hh1Bp3B50Bhhh@hh1BTd3Bhh5P2Bh@Bhh5L2Bh@%x@ÉUE;0.Buh|50Bh1BO ËE;0Buh|50Bh1B% ËE;0Buh|50Bh1BÐUSEXà  $@5@+׃5(@+׃5@@+׃5X@+׃5p@+׃5@+׃5@+׃5@+׃5@}+׃[5@Y[ -B[ 3B[ 3B[ 3B[[n[5@[ÉUSVuƃt tut`@Bf@:l@2 w <@$TA uVhr@h3B.׃ 3B^[ÐU=3BtAh8@h*E%׃uh*KhB@h*#%׃h*$׃EX4B@h3B,׃ u u$53Bhd*a@ÉU`SVW] uhF@h5d@S =3Bt3P5|@h*x$׃ ŖTAs ŖTAu?C p!u@@]<@@MHM#ŖTA uC p%Es ŖTAuBCp#!u@@]C@@MHMŖTA Cp{$EsŖTAu?Cp u@@]<@@MHM#ŖTA uCp#E t$@CE;-Bu'@@EhMAu$ TE;,AtcE؋@ uSE؋@ tBuP u*E؃8uf@ E؋EȋPhp@!huuEu$ tdu# uUE؋@ thu_thhuu. phu<:E؋@ t9E؃x}05-B thu`P@@MHXE@ t E@  u E@ u E@ t@@M؉Hur# tu{PE@$u*huE@@MHu{P5@ayCEusPWWsu@@CX0@@KHK Hs;Eu5@sT E@s Eu5@s$ E@= @C@E؋C lBHsCM؉H@@E@E@s JE@C p Puue3 %EEf; h"׃E=,z@uE,z@}t EMH @C 8 u5@#׃7s Eȃ@@PEMH E@ @[EEVE0z@C\z@h5\z@Xz@@@ Xz@H(CEԋC EЋEԋ@EuEu uuPhuu3@@EEЋ@@E@@MMH@@@E= @rCE؃=@u E@u EuvE܋E@tQE؋@ t%E؋@ t0huvtuhuuG}u5@E@u;uu4@@E܋E؋M܉Huu uuu@@@E= @MCE؃=@uE؋@ x tE؋@ @ @u Eu?E܋E@tQE؋@ t%E؋@ t0hu?tuhuu}u h@|E@t E@#u\E؋@ @uME؋@ @ @u;uu@@E܋E؋M܉Huu%uusCpHs{ s @@EX@@MMH@@EEX@@M MHr@@M#MHX@@M3MH>@@MщH%@@EuuuuyEEX@@M+MH@@EmX@@MىH@@EX@@MMHv@@EMX\@]u5@#@@E}X&}u5@@@EE}MA}u5 @@@EE}EP@@M;MɉH@@E]EMAs@@M;MɉHS@@E]EMA*@@M;MɉH @@E]EMA@@M;MɉH@@E]EMA@@M;MɉHx@@E]EMAO@@}ɉH1@@E}t}MA@@E}u}MAs s&ss s, {u5-Bh@Y׃sEăus5$@Ogu׃s=-BD+AlA=pAuAhh0Phh0PhEs0 Eu=`A-BFKEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u~ ơl.Bk -B;'hh`/P-BthI/PhD;/ Eus=_)]S,S/|s6ls \@@E{CEusuMCEV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uuuGDsuuI Ms=@@ECEV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uuuAlsuu2H VS*HCEԃtfEp)Eԋ@p`h*=h*}hd*h < ׃d*d*ܱ Eԋ@ Eԃ}uh*=h*}hd*h ׃d*d*ܱ Cp!xs uu@@MUPY@@MUP=C8u(@@EKqKMA @@EKq#MA -BEȃ{-B=8z@~1{ tA]\-B@4u8z@=8z@8z@Eȣ-B{@Xi C8uCpvN Cpsv; ʹ1 C8uCphd*9u Cphd*!u C8uCphd*tCphd*th*=h*}hd*h ׃ d*d*ܱ  CEԋC EЃu?}uhhhߣ hhEp£ : EЃ8u[EЃxu@ EЋ@EȋEuu׃@PijP׃PhEp_ Eԃ8 uEpEp @p8 EphEp Cp+ hSTl hSAY {@ tHtt+u95<@׃5T@׃5l@׃5@׃5@׃HNAtt%u05@׃05@t׃ 5@d׃5@T׃- C@HNA=HNAo 5-B,\ {u5-BiC hs5-B0 ( SK S$L s S {uh@h$5@C C8 uh@h%5,@ Cp萻 {u 葶 C@E;-Buhe uU S0G 1= {u5-Bg$ hs5-B {t=5\4B ׃C\4B=-Bt15\4Bh@5-B ׃ 5\4Bh@w׃{uhZXC8 uh@hV5D@ Cp"X^=tAu =pAt5-B(9hd*('=-Bt5\@h* ׃Ts si"C pCphs/HS SCp^{uh"@h5t@ײ C8 uhB@h5@貲 Cp,S~s sh? CEԋEԃ8 u\Eԋ@EЃ8 uhb@h5@@ Ep? uEp5@花Eԋ@ E뜋Eԃ8 uh@h5@ EpP? aEph@1IpG?L5s1  "s Fs shz> h@PPsds sTs(e{uU0h*=h*}hd*h ׃d*d*ܱ 5-B5-BPC8cC@ xu&h@ ׃5-B5-B7U =-B5-BP賴5p4C5-B׃ u-B;l4C| -B;h4C~Bhh"P5(Ah!PhE! Euc5-B5-BsP5-B-B8u@-BEȋP5-Bh@5-B׃=@h@ ׃=l.Bv5-Bh@ ׃ h@ ׃5-B5-B<=-Bb5-B3P^5p4C5-BB׃ u-B;l4C| -B;h4C~Bhh P5(Ah PhE  Eu5-B5-BP5-B-B8u@-BEȋP5-Bh@5-B}׃sC x@C ph @5-BB׃ s5-B+h@5-B׃Cpth@5-B׃-B@x}5-Bh]׃-B-B@x}5-Bh )׃-B h@5-B׃@?h @f ׃shd**h$@I ׃Cpsh*=h*}hd*h ׃Pd*d*ܱ 8sh(s T-B ss sI {u+ CEȋAE}}u+ EEȋE}u+ EEȋAEE8eu -B}usI{=-BtrC@Ae=-Bt\C@AO=-Bu]*?5@׃/5@׃5@׃3h(@s=3Bt3P54@h*׃ _^[USV}u+ EEȋA t' u+ u+CV u^[ÉUu U u5L@GÍ`4B;@v5d@蹪u u5@W E @fD$@ h4C;fUEt tu?t)@@M HÃ@@fM fHÃ@@M Hu5|@U SVW} uoE@ Ef}tE@u E@ E}u+FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t+ۋ_^[UE8uEp u@@ÉU SVWEpx @E uuWE0N _^[Ã>ct>uuVE0J _^[ t!?cuhuWVE0M_^[Ëރ;t;4u[;udC@ t C@  u C@ u C@ tuWsE0_^[huWVE0_^[ÐUSVWExX p u5,Ah؃;cu5-BVSWE0j_^[5-BVSWE0s_^[fUSVW} u5,AE pVhP5-Bh{Ph+m hhYP}Ru+Ph;Phhc( Pha ؃}tS}Puh\ SaP}SPhf S=PWh/ C 7 t s 9_^[fUSVWE 8uJu 5-B5-B׃@P蹞P׃PhRPhcD ] }Su&S5-Bh#Ph+ $S5-BhPh+ hhPSha }tV/Puh\ VPWh. E  t u8_^[ÐUSVW}Su(u5-BhNPh+@ &u5-Bh&Ph+ uhEPu ha ؃}tSUPuh\ S9PWh- }tVu MEH t V7_^[USVWu h^j\ShVzP 5-Bh6P5-Bh"Ph+ u h`PmPWh] ShVP蔮 }tSuh\ P$u hP5-BhPh+| SWhk, E t up6_^[USVWE p~h5@腞}u u 2 EEȋA u5,AuhPu h_ ؃}tS5Puh\ SP}SPhf Vh|P5-BhhPh+Z SPWh@+ C  t s E5_^[ÐUSVWE@EEx p}tVWuE0T_^[he tSCPVh\ t ? uV\1EGE@uhP5-BhkPh+] E tHSPE8QPhf2 SPuh* EC SyPuh) E@g t u3=-BE8P uuct4CE@ u:E@ u*E0t4CPhh@5-B׃_^[ËE0t4CP5-B5-BP5-B5-Bh@5-B^׃_^[SVWE0 _^[ÐUSVW}Pu(u 5-Bh Ph+  &u 5-Bh Ph+  =-Bt}Pu @uPWhr( =-B}Pt }Q}uuct4C}Pu5-B5-BE X=-Bu 6t4CPSh@5-B5׃.6t4CPSSP5-Bh@5-B׃@7 t V1_^[ÐUSVWE pC~hh@ٙ}u)E 8u5,Au . u5,AEpu hd, ؃}tSPuh\  SsP}QPhf  Vh P5-Bh Ph+  SPWh& C  t s 0_^[fUSVW}hhhhh&FFX t(EhhMA@FEh@MAFEV5|BhhhMA_^[ÉU0SVW= @ @@@E|4CE4CE @@ uh@h5 @A E @@@ uh0@h5$@ E @@x uhP@h5<@ E @@puE p1E u 2uh E ]EpC@C;0.B15|Bs G E @@5|BE @p oG hhp@uEucE؃}t)fE؋;EuE؋@;-BtE؋@$E؃uڃ}u5T@׃_^[ @E|4CE 4ChE pWPhPh  PuhrPh4d Ehu蹟E@@ t1E@x}%5-Bh t5l@z_^[@uE@EpEE pCt2Cu5|Bs o u;pBt ;tB|E @;|Bu E PE @@ uhx@h5@A E @@@ uh@h5@ E @@x uh@h5@ E @@@C;0BuwCun~E @@xWE܉Eԉ0EE @E ~E؋M܊EE E p׃E @E MԉHH;u}5E EuM q׃MЉA;u}E @0 F;u|E @@xu ;}}h}~bC;0Bu C uh@h5@ )=@Wuhx4CA Wu5@A _^[ËEpPE pP  tEE}E)@Ettt$t_uu5@@ _^[ËE@@ u@Pu_^[uu5@F@ _^[ËE@@ u@p0u蘆 _^[uu5@? _^[uu5@? _^[ÉUSVWEp EE pEpuu }u@@]@@EhSEPH? uZu@@]@@EhSEP> _^[Ãu@@MHM@@]hSEP> uu@@MHM@@]hSEPj> _^[ÉUSVWu } uhhM_^[ uhw4_^[hh@;GuZ^5BSb u 5lBSO u h@ޏV@@0i_^[Vw~_^[ÉUSVW=-Bt=lA}+AlAE@8E@pFu5@McV؃u%>u@ EȋP5@SPSwEPEPWH V苗؃u$>u$@ EȋPh.@贎S蓶PRSEPEPW Ep@@EEp l@@E}|}}?5@h*׃_^[Ã}}=-Bt0AlAEEAEE$hhH@PREu A u@@A(AEA(AE=-Bt3A=h@M+ȉMEAEE}EEu=-BtlE;E}5,@h*׃_^[ËE+E;A9E+E A+ȋ=h@M+ȉMEAEEuu?_^[fUSVWE@8uQE@xW؃u$?uT@ EȋPh^@BS5A/AEp8@@Ep @@0 r s5D@h*׃_^[ u` uH=Bt&4C;-Bu5B5A5-B5AS5An u55-BV薷؃u5\@ES5A2G;s8hx@h*׃_^[Ë+;AsS5A VS-B4C_^[fUSVW++ E #@ tk t@@Pus׃4@h׃ȃN~h@uI׃4@h@u-׃ ؿFƃ {_^[ÉUS]=-Bt%=pAu =tAth@5-B׃h@S׃h_zPh@S׃ h@S׃h5zPh@S׃ h@S|׃h zPh@S`׃ h@SR׃hyPh@S6׃ h@S(׃h@S׃hyPh @S׃ h@S׃hyPh@S׃ h(@S׃hUyPh0@S׃ h:@S׃h+yPhB@S׃ hL@Sr׃hN@Sd׃hxPhX@SH׃ h`@S:׃h xPhl@S׃ hv@S׃hx@S׃h xPS7h@S׃= @h@S׃hhu@ EȋP5@ZSE-BxWP޽W衮(A=-B(A@+AlA=pAuBhhP5(AhkPhE] Eu϶=`Au=hh4PWh%PhD Eu艶_^[ÐU SVW=(At5@K5-BE@8cu+E@@xE@@ @EWuOEp@@tbS襴PЇ;5-Bt*h@u u5-B5@诂_^[É-BShNvʽ)_^[U54@׃5L@{׃5d@m׃5|@_׃5@Q׃5@C׃5@5׃5@'׃5@׃5 @ ׃5$@׃5<@׃5T@׃5l@׃5@׃5@׃5@׃5@׃5@USVW}FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uËEEV:@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u5D@h*׃+ÉUS]SV>@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[VD@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[VJ@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[VP@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u+[5\@h* ׃[US]fP'׃CÀ;u[fUS]fP ׃CÀ;u[fUDSVuhu [;u+^[Ë $@@@]@@MHMz@@]g@@]T@@EE]:@@EE] @@EE]+^[Ë d[$l@@@EXC@@MHMH&@@E}fMfMf fMm]mMH@@E}fMfMf fMm]mfMfH@@E}fMfMf fMm]mfMfHt@@E}fMfMf fMm]mЊMȈH=@@E}fMfMf fMm]mĊMH+^[ø^[USVW=-B=tAu =pAtoh׃Eh׃54C׃u u=@Wh@5-B׃ E +E;As AEE +]_=-BtA=tAu =pAt/S%E tuh@o׃ h@`׃E +PS萳;] w;vB=-BtH=tAu =pAt6h@5-B ׃h׃u׃u׃_^[ÉUSVW}5`@v_^[Ã=-B=tAu =pAtphP׃Ehs׃54C2׃u xEu @Euh@5-BE׃ E;A}AEEEu +;]}i=-BtA=tAu =pAt/V藡E tuh@׃ h@׃uV+)EC;]|5B=-BtH=tAu =pAt6h@5-B|׃h]׃u׃uG׃_^[ÐUS|@f;MEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^  u 0;uu5x@t[ÐUSVu ]fff -f=5#$|@hVEP! =@t-Bd*܃@x}&=@t-Bd*Ph N׃!=@t-Bd*܋ =@t-Bd*܃@x}&=@t-Bd*Ph'׃!=@t-Bd*܋'uKK=@t-Bd*܃@x}(=@t-Bd*Ph'u׃^[Ã=@t-Bd*܋'^[hVEPx EPs׃^[hVEPR EPs׃^[hVEP, usc׃^[hVEP E$s9׃ ^[hVEP uus׃ ^[h@h35@r^[USVWE;E v5@qut+];] wF uSh@׃SWGFƸ;h@׃+G;] v t h@f׃B_^[ÐU$SVW=-Bth@5-B.׃} h"@?quEV@@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ EEVB@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ E+] EE;EBf uShD@v׃}hL@_׃hSEP E tA';)uEPl? EPBChSEP hN@׃+}t`hR@׃hSEP }t'uFhSEP[ }uhT@׃+.SW#FƸ;hX@_׃+GEE;E t hZ@8׃B=-Bth\@5-B׃_^[ÐUSVW=-Bth`@5-B׃u EVf@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ h*=h*}hd*h"׃d*d*ܱ"]CE;]sP=C;]rh*=h*}hd*h"+׃pd*d*ܱ"XEVh@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ h*=h*}hd*h"7׃d*d*ܱ"uFE;usf6C;urh*=h*}hd*h"۾׃#d*d*ܱ"uw9׃h*=h*}hd*h 蔾׃d*d*ܱ =-Bthj@5-B׃_^[ÐUSVW} s =(Au hn@u׃ u 肜;4@t)C0@;ut@ Eȋ8@4@E +0@}t"EPEVM+A t+ +Ǎ<@PV58@h~@u׃_^[ø +ǃ<@P58@h@u׃_^[u h@u׃ _^[ÉS+ۃ|$~D$D$CÃ|$[fUSVW5-B4 tG5-B~ u5TNAh@J׃荇W5TNAh@/׃ ·5-Bh*=h*}hd*h u׃d*d*ܱ Wh*=h*}hd*h 5׃d*d*ܱ h*=h*}hd*h ׃d*d*ܱ =-B=-BhVFP9E5-B8u@5-BEȋV@;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t u5@5-BDEu @EE@ u5E@ u%5-B5-BVh@5-B׃5-B5-BVuhA5-B迾׃5-B5-Bn=-BhSP腭E5-BP8uA5-B5EȋV&A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t u0A5-B莍Eu 2AEE@ u2E@ u"5-B5-BSh4A5-B1׃95-B5-BSuhHA5-B ׃5-B5-B蚃_^[ÐUSVu |;5"A~V5@׃4!Ah\A׃5-B؃u! |?}:4`@h`A׃^[Ãu ~ }4l@hfA_׃^[fUS@ @hh> tS5@׃5(@׃hhlAPPh3 tv[ÉUSVWu5-Bi-B-B=-BuB=p.Bt9V& u!;tuV)Vۉ=-B -BV VBEu_^[USVW}54C t;>u fF_^[Ëv uhWEP  h _؉;ECfC4CC4CCAEhWEP$ _^[USV+4C tWf;EuDhuCP fCC u= u C4CCFS`׃+^[Ë[ uu5@@b^[fUSVWu\uA EȋP5AZ_^[Ã=-BthA5-B腲׃h \ u5AZ_^[-BS4S tA5-BEh[;ut tSSܩ u3-B;ut u t$S_^[h_^[US=3Bth=JP5,A藶׃=-Bth#-B-Bh-B=3BthIP5DA7׃[UhuÉUhuÉUSVu} t9hI;t\=3BtVS5\A͵׃ } tVhsV} tc u^[ÉUSVW-B@4 uh貯׃_^[Ã=4Ct5tAh*;׃Smm5-BP2]r-B@6u-Bq_^[ =-B=-Bt+ tJ5A׃h*=h*}hd*h ׃d*d*ܱ =-B=-B5-B<8uA5-B!EȋhV0P#EV A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t u5 A5-Bb~Eu  AEE@ u5E@ u%5-B5-BVh A5-B׃5-B5-BVuh& A5-Bݭ׃5-B5-B茊=-BhSP補E5-Bn8u: A5-BSEȋVD A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t uN A5-B| u=P AE@ u2E@ u"5-B5-BShR A5-BT׃75-B5-BSWhf A5-B1׃5-B5-Bcr_^[-Bv_^[ÐU5A׃5-Bhd*_h*=h*}hd*h 3׃d*d*ܱ =-B~=@uV@-B-B-B5-Bhz AWËD$@4ÉD$@4 f-BB4uB6uǂH +ɋÉD$@6fD$@8fD$@FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tG_^[UhuÉUhuÉUSE@}CfE@@;E u*;u A EȋPh*A׃S\P5ACh*=h*}hd*h !׃_^[Ëd*d*ܱ _^[fUSh*=h*}hd*h(ؖ׃d*d*ܱ(EX t>;u.A EȋPh8A׃{t h<A׃[ uƒh*=h*}hd*h)Y׃d*d*ܱ)ExtNh@A豟׃EX tofCtCP5A7ChS[ u[Ãh*=h*}hd*h ˕׃[Ëd*d*ܱ [ÐU4SVW}G : 1 $AG @G @ @G @ xhWKEhuEPl E܉EhBA=@t-Bd*P肙׃huEP. fE t&EPEhuEP hDA=@t-Bd*P׃w _^[w _^[Ã= @t"h \z@p 50z@h W #_^[W_^[ËG @uw h_^[w  4+$A?uFA EЋȋEVPA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u3W还PhZA=@t-Bd*Pv׃ :W茘P_^[Ã?u^A EЋȋEVhA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u3W谗PhrA=@t-Bd*Pg׃ +W}P_^[Ã?uvA EЋȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u3W衖PhA=@t-Bd*PX׃ ?uA EЋȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uW評P4@@@$hB  _^[Ã?uA EЋȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u#@@p0hZ  2?uA EЋȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ @@]hA=@t-Bd*Pk׃@@$h6  hA=@t-Bd*P&׃uuh hA=@t-Bd*P׃5A:_^[Ã?uA EЋȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ @@MԋHMhA=@t-Bd*PӐ׃@@p0h hA=@t-Bd*P葐׃uuhj hA=@t-Bd*PZ׃!5A8_^[5 A8_^[hA=@t-Bd*P׃wghA=@t-Bd*Pߏ׃_^[G"vGPhAs8WP5$A7_^[fUSVu ~D@@VPhA=@t-Bd*PO׃ ^[U}u&hA=@t-Bd*P׃h A=@t-Bd*PÉUS] ;3Bt;|3Bt;x3Bt ;B=lAt*uhA=@t-Bd*P蜎׃ [Ã=hAt*uhA=@t-Bd*Pi׃ [uhA=@t-Bd*P?׃ [5<AR6[USE@t uTA"A u؋[ÐUSVW}w؋G@t G@ t C u14uh*h,Ah*肍׃5JsE @EpsEF uh>Ah5lA5 5Bu襑 uaI4hbAh*׃uh*^E@ 8unAE@ EȋPhxAh*׃ E4uWh g FGuC GE @ E v} t } u tF3} t5Ah*V׃5Ah*A׃Wh*蛲3_^[USVWu+Fu^v nF uhAh05A4 F @ uhAh15AX4 F p F X;tKfC uhAh85A4 EPEPS E+E@[;uEPEPS E;E|E;E~${t{t@5A3@@M+MM H_^[fUS]C;C}C[ËCC P[fUSVW+Ex tcG uhAhl5A!3 k Pk PW k k FƋ uDžF |,k k + @ }֋Ep WuF+)@+;hA=@t-Bd*P草׃ Dž;~Bk hA=@t-Bd*PG׃ ;h A=@t-Bd*P׃Ep E@P;~$h&A=@t-Bd*P贈׃C;u+)@_^[É+Ð+Ð+ÐÉUSVWu} t7E X#EDCVE pE@P CËE ;~_^[Ë=Xz@+;]}c4DCh(A=@t-Bd*P׃ 4DCWV @@8 uF p v C;]|V%PWgh.A=@t-Bd*P胇׃VNh2A=@t-Bd*PV׃_^[ÉT$D$ t;tOtu]t;|3Bu+;|Bt;t3Bu+;Bt;l3Bu+;Bt;h3Bu+fD$fUSu\f؋E;>ArLNA>A;Ew+[ø[fUhuEP1 EÐUSu@`fC t S{[ÐUu8uAuEȋEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ÐUEPuup|}ÉUSVu~s+.~4t~tvwM ^ vb u}tFPGM ^[ÐUSVW]hFCEPss-p| C4thE hC+ }VD Fƃ |+}3VBE+ }k NjM 9LFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u }@EuU@+E; CEVXA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ H3Bt0C EV`A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u4@@MHME]@@EX_^[ËC EVjA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[ËC EVpA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[Ë+)@_^[ËC EVxA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[ËC EV~A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[Ë+)@_^[ËC EVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u4@@MHME]@@EX_^[ËC EVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u'@@E݃@@E_^[ËC EVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[ËC EVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u@@@_^[Ë+)@_^[Ë+)@_^[s Ep_^[uL_^[U SVu}h ؃} tVS'o^[Ëƃtu(t@@X^[Ã@@fX^[Ãu@@X^[Ãu5@@X@@Eh MA^[VhA^[ÃuB}t ]@@MH^[]@@MH^[Ã}t@@E EX^[Ã@@E EX^[fU SVhhA1P$_f tDC t C  u C u C u[$ hhAP^ +hVg EhPhG hhPEPh hShhP+^[ËD$fUSK$fS4TACÁK~hAhAhAhAhAhAhAhAhAhAthAhAbhAhAPhAhA>hAhA,hAhAhAhAhAhAh AhAhAhA=x.Bt hhhA҇Ph hgPhh&A複P[ÐUSVW+ہ}64xEC t~Vm׃+ uxECCÁ|_^[ÐUSVE+50Ah)؋ExECCxEC^[VD$+54A xECf t ;D$tI^fUSVWE+58AU‹xEC+f t;Eu C%;E t[ t+ uEK xECCFSwl׃++_^[ÐUSVhuBV؁cE C^[ÐUu hhuPÐUSuf t;Eu C%;E t[[ÉUSVhu uu s^[fUSVhu u+E KEK ^[ÉD$TAfUS}uuF[hu' u u؁cKE CEC [fUSV}+ xEC C% tA;u2A EȋPh<A~o׃ss hFAco׃?;uNA EȋPhXA=o׃sys h\A"o׃[ [FƁ<^[hu uhbAn׃^[ss hdAn׃^[ÉUSV}hhAn׃}u+ EEȋA tQ u+ u+C ujAPhtAKn׃  u hxA5n׃ uh|A$n׃^[Uhu= u$}u~A EEȋP5AUSV] u ^[SW t uAPhAhS u SDfNE FhhAg;u x.BhhAG;udA^[hhA#;=-BthA5-Bg׃tA=pAt)hhAځPpA^[Ã=`AehhA褁P`A^[hhA{;=-BthA5-BKg׃pA=tAt)hhA2P5tA^[Ã=`AhhAP`A^[hhAӀ;=-BthA5-Bf׃`A=tAt)hh(A芀PtA^[Ã=pAhh.ATPWpA^[hh8A+;u@lA=hAhhBAPhA^[hhLA;u<hA=lAtmhhVAPlA^[hh`A;u @^[hhjA_;u  @^[ÉUSVhu: u+s^[Uhhu P ÐUS]hS u urAP5A hh|A~;u x.B[hhA~;u lA[hhAi~;u hA[hhAF~;u pA[hhA#~;u `A[hhA~;u dA[USV+ہ4xEC F%uj t hAh׃>uA EȋPhAyh׃~thAfh׃vhd*蹉hAIh׃v ~CÁ_^[fUhZ Ah^ AB4.B]蕒fUSDUC} CMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^  u[X2 uDUC[f|$ u p AËD$ $ $USh\؋EE CDUCCXDUC[fU}uhv AhXh A/ }  uh AhYh A E MUTfUS}uh!AhchD!A E M\ uhx!Aheh!A [ÐUSVXÃMu>tÃ΃ XPuu u`^[ÐUSVXÃMu>tÃ΃ XPuu ud^[ÐUSVuuu uCja׋hhXg׃EPSVh=g׃E^[fUShd*z_׃_׋ =-Bu =@tjh]׃5`DC]^׃h]׃5\DCB^׃hh]׃5XDC'^׃=4Ct:54CC]׃*E @Ph:E@Ph%uul^׃hhZ׃[ÉUE;E tu\׃u ]׃u \ÐULSEPhD*-EPhd*-hx#AY_׃ u~#A}t,E t"huh#Ahd*hD*Sqhhd*hD*SWEPhD*-EPhd*-[fUSh ra׃؋EXUCCXUC[fUSV+XUCf t;Et[ t u CXUCCFS]׃+^[fXUC t ;D$tR ÉUSVWuG tE KS~]׃+_^[ÍEP3h׃E%E=LDCt}~f;ut } VE%E;uuw tfEPg׃E%E~u;utDu+u:V u-;5,At%h `׃؉3ECTUCCTUC uh tpuEPbg׃;utS |MV u-;5,At%h _׃؉3ECTUCCTUCEPg׃;uu+Vf ;5,A# t%h G_׃؉3ECTUCCTUCEPf׃ }7u uE _^[ËE KS[׃+_^[ËEt"u6=LDCt u輱E=LDCt V蹵EE M_^[É+ɋTUC t;D$u ʋR u t u BTUCBAÉUS}}%h'5"Ah$f׃ h"V׃u^׃ u%h5 #Ahe׃ hU׃[ÉUSV} |E ;"A E !A#Au^c׃ ~(Vuhe׃ hh#Ahye׃ S'c׃PShae׃ hh#AhJe׃ ^[Uhd*Y׃} t!=PUCt5PUCh#Ah*Y׃ =LUCt5LUCh#Ah*Y׃ HUC ~HUCPh#Ah*zY׃ }tuh#Ah*_Y׃ uDu@u uuhv$A5x0BeN׃ Phz$A5x0BMN׃ C;] |‹E E+Qpu 5x0BM׃_^[fUSVWuEދE E} }4( FPh~$A5x0BM׃ ك}f4$FPh$A5x0BM׃ Gǃ4~hẼ}4, tFPh$A5x0B:M׃ E}Oh]E EE2*f CPh$A5x0BL׃ E}2$CPh$A5x0BL׃ 2~hẼ}4, tCPh$A5x0BVL׃ E}khyu _^[É tFPh$A5x0BK׃ ݸ+E P3cf tCPh$A5x0BK׃ ݋E E+Qu 5x0B&K׃_^[ÉUh$A5x0BmKfUS]Sh$A5x0BPK׃ }h hw}Sh$A5x0BK׃ Sh$A5x0BK׃ h ;h5x0BtJ׃[ÉUSVhh$A5x0BJ׃hE%Sh$A5x0B{J׃ h S+QSh$A5x0BDJ׃ hh"Rh`h$A5x0BJ׃h@E%Vh$A5x0BI׃ h VX+Q4Vh$A5x0BI׃ hh5x0BI׃^[Vt$ƙ|$ ~ƙ|$ A ^USh FCC[ÉUSh ؋ECC[ÐUSVW}u uhN*Ah=hp*A @~u ~~_^[Ã} u^] _CG{tCx~{_^[fUSVW}u uh*Ah^h*A @~u ~~_^[Ã} u^] CG_{tCx~{_^[fUSV]u   uh*Ah~h+A uhP+Ahhr+Av > uh+Ahh+AU {uCF CKH{uCF CKH^[ÐVWT$ |$ u( u GJHBOHGB_^ÐUVWhE׃`DChE׃\DChE׃XDCE PUC5PUCO׃P!J׃\4B\4B5x.Af5PUC5\4BxO׃hz.A5\4BeO׃u u E=-Bt'h5-B&M׃hhd*M׃h XChd*M׃=4Cu=`UCu:u=hCtMhCt%u/h|.AJ׃uu ul fh.AJ׃Wh.AJ׃H5TNAB@t*t2u-h4/AJ׃uu u hp/AyJ׃L6=4CtVhUCaL׃ u; hCE;E}"hEM 4ɍEE;E|: 4ChUC L׃ t53Bhd*iPh&M׃= @tTDh*=h*}hd*h @׃d*d*ܱ hc_^UHSVW+h/Au;D׃ VhhEPLD׃EutELE ~hEPV*D׃ +aVhh(EPC׃uMhh/AEPL׃ u uE ~ uGE;VB׃_^[fUSV}tu YEPF׃+;]}E C;]|=`UCu C /A C TNA /AVh/A;B׃h/A[^[Uh/AG׃=-Bt h"0AG׃hd*LBÉUSVW3B53Bhd*ju=TDCu =4Cuhhh; 5,AJG׃hd*A׃=t.A h$0A5TNAA׃ u5TNA5,ArShh0@PA׃PHhCBLhChHhCPSA׃ EDž|hE|m=LhC`Shh(hPhCzA׃VPhC5&0A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^E ES@׃xhdhCPS@׃ ScB׃thdhCPS@׃ +E8C{} S;׃8GNjE uh/u"I׃@E8V,0A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^E u Dž|hxS\?׃ LhC}t\׃5TNA\t.Ah40AC׃hd*P>׃=t.Au5,Ay=-Bts=t.Au6pA`Ahhh60AlXP4pA`Ahhh@0A6XPI=TDC5WC5,AC׃=x.Bt׶#=WCt5TNA5WC5-A %!5-BPhh[XPhkMX<<F=@DCt+h-B5-B6Pah-B%rhH0A5A=׃ t!V<׃h5AhJ0A=׃Etk5AuhP0AEPnE׃hV0AEP<׃ t:V<׃hEPEPE׃@PPqE׃P&p.A_^[USVW}hX0A\@׃VbVzhhh hf0AA׃f4hj0AA׃CÃ<u} tu hn0A@׃}tuht0A@׃h*=h*}hd*h &7׃d*d*ܱ c~`,Ze5TNA&YNphd*:׃hVVE׃ thhUCX>׃_^[fUS3~B`%,0\׃u6C;]|5t-AH4t15-A*!Pyt h0Ah0A54C5׃-Bhh0A4q>׃ uhChh0A4I>׃ uhChh0A4!>׃ uhCEEPEE uU uTNAB=TDCt9=t.Bu0h0A44׃t.BWC=t.Bu TDCC;]}=4Cu45-A hC_^[fUSVW}ulh6׃ t[5TNA5-A9׃=-Bt5-A8׃hd*3׃hUCu5׃UC t UCTNAh0A5TNA3׃ u5TNA5-A :ShhhxhC3׃t5TNA5.AS2׃h/5TNA tW5TNA5TNA7<׃@P3P<׃h/V^5-BhVPn =TDC=t.Buy=x.Bt;h0Ah0A2׃t.B0AWC=t.BuE5.AJ5h1Ah1Ai2׃t.B 1AWC=t.Bu TDC=|0Bth1A<׃|=|0Bth1A<׃_^[fUfEff f=-$+A4CTDC|0BWC-B3B0B0BlUChUCx.B`UCXCh"1AhT1AEP54.AÐUh4CEPhXDCEPh\DCEPh`DCh1Au9fUSh$[ÉUSV]u VhTCP<3׃ FPhtt@CP&3׃ FPht@CP3׃ hhCP/׃ F ^[USV]u FPhtCP2׃ FPhutCP2׃ VhTCP2׃ v hCP/׃ ^[ÐU5-BuM/ÐU SVWE=hUCtu54A4׃=l.Bu=hUCt5 4A4׃+_^[á-BM;s +Ev+ۡl.BE;s@+53Ak -BE;Eu EE;Ev_G;r}uk -BM;rCk -B@E=@u{}t HNAih.u/E;EvE.uEu0Bh50B^ t HNA HNAE_^[fSVW=p.Bt-BL$(;Hs D$+ۡp.B-BL$(;Hu \$-BL$(;Lu t$-BL$(;Lv|$,tƉD$~f+53A-BDD$ D$ ;D$(uD$(;D$ v_G;v‹D$ ;D$(u|$-|$,t D$-BL$(;Lv\$CD$D$_^[ÉUSVWhu؃unu t F u+FEu Efu Eȋ LNA >A;MvtEΡ-B<ء-BD;EtYuF u+;-BD@PrE;t!Cá-BD;Es;p.Br-B<؋_^[USVhu؃u+-B4؋^[ÉUShu؃t -BD[Ã=p.Bu+[á-BM;Hs+huaCC;p.Bs-BK-BD;Dtݡ-BD[ÐUSVW=p.Bu _^[Ã} u-BE E-BfCM EMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uUEsl.Bk -B;u=p.BC x;}$-B;Eu-BD_^[F;|ރ ál.Bk -B;}uu 584AG_^[ÉUSVW=p.Bu _^[Ã} u-BE E-BfCM EMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uUEsl.Bk -B;u=p.BC x;}$-B;E|-BD_^[F;|ރ ál.Bk -B;}uu h5A_^[fUSVW=5Auh.5Ahk5P4A ++;5A t#Ck |hCk  |hC񥥥Ek  |hC EMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uC;5A t 5A_^[5h4Au_^[ÉU=hUCtu E0hR5A ,׃ =5Aud=hUCth54A+׃hp|hChC|hCM|hCM H|hCMH5Aá5A;hC|%hCkhC P5|hC,׃|hC5Ak |hCM5Ak |hCM H5Ak |hCMH5AfUSVW+ۡ5A|hCM;HsuE,A_^[á|hCM;Huk |hC_^[k |hCM;Hrk |hC_^[;F=3Ak |hC@E;Euk |hC_^[ËE;Ev_G;~k |hCM;Hvk |hC_^[ÍCk |hC_^[ÉVWD$$PD$(p;s ;v D$$D$ D$(D$|$ t,D$ ;hCuD$@u ||$t)D$;hCuD$ @uSLD$$L$(@;A}5D$(L$$@;A}|$ u|$u+_^ÉUhh5A">hClPh 55A5|hCG)5AÐUS+;5A} k |hC0蜊C;5A|[fU=hCu-hhChChChChCmhC;hCv`hChChChC+hC=3AP5hC(׃hChC+hC=3AhChCMhCfU졘hC;hC uh5AhG54A~ hChCfU SVWhC+;5Afk |hC8tek |hC@um uh5AhY54A CPk |hCKk  |hC H !$Ek |hCMk  |hC C;5A];55A^fk |hCxv;55A}k |hC;xuFF;tk |hCNk  |hC񗥥C;55A~+@)5A_^[ÐUSVh5AuA!׃h5ASJ!׃+;55Ak |hC8tk |hC0h5AS!׃ h5AS!׃k |hCp54AS ׃ k |hC8tAk |hCx t"k |hC@ 0h5AS ׃ h5AS ׃h 6AS ׃F;55A>S ׃S׃^[US+ۃ}->A;EwLNAThC/hC hChChChChC^[5hC5:A*׃[fUS];1u{1us [Ã{ ts hF:A׃h*=h*}hd*h(I ׃d*d*ܱ(;1t48AhJ:A׃{1tq;1t7h*=h*}hd*h, ׃d*d*ܱ,C48AhP:AC׃{tKPhV:A%׃h*=h*}hd*h) ׃[Ëd*d*ܱ)[ÉUSEtttu:t<2)} t 5>A\+ۋ[ÉUSVWu ]=lUCt$5hCv5 >AM׃ hd*׃F $;A_^[=hCP6C_^[tt*t<tHC7AC)7ACo7ACXE=hCuM7AC ~uCP__^[tt-tEtW|7AC_^[_7AC_^[B7AC_^[%E=hCuM7AC_^[8AC_^[48AC_^[T8AC_^[xt8AC_^[FttYt7AC_^[Ë7AC_^[Ã=hCu7AC_^[F8AC~t ~hC_^[C1C C=hCuC_^[C1C C=hCuC_^[=hCP6C_^[=hCP6C_^[C_^[C_^[fUS]=lUCt#5hCu hZ:A2׃ hd* ׃E ttt uet)[C)[C[uS8AC[CP[fUh+-BZ_ uYHNÉUu9Yh5-B-BfULSVW}=lUCtW58>A$׃hd* ׃5-B茢؃=lUCtS5P>A׃hd*y ׃ t EPW3 uƁ|W|=\} t hCW؃=-BSEE@ hC]SMhTS:N^)hCW?| P}MWhWPM;=-Buh5-B-B/|~u W hCߋ_^[ÐUDSV=lUCtu5h>A ׃hd*׃+ۍEPuW t*u} u}u>u F=$A ׃ hd*׃u;u EPV uV5>A'_^[ËEt{tvt5tt uXt9^];uVQ];uI{uC+_^[Í];u4{u.+_^[Í];u{u];uC _^[Ë5hC;u D_^[ÉU S\Am ׃)@SEP5@Z E=(hC Ph5hCT Ph5hC; 0Ph5hC" Ph5hC xPh5hC @ Ph5hCע Ph5hC辢 Ph5hC襢 Ph5hC茢 hCÐUSVW]u B;p u C t1hCAs  uhCAs    u8|B;p u C thCAs    uTB;p u C t1hCAs X  uhCAs A     u8xB;p u C thCAs   _^[ÉSVW\$t$;Bu F uCu ;5B _^[ÉSVW\$t$Cu F t;^  u(Cu F t;s  _^[ÉUSVW]u Cu{ t F t!5Bvp T  tv s :  ukFu~ t C t!5Bsp   tv s   _^[ÉSV\$ C;4.Bu C t C ;|B^[fUSVW]u S t F t|Bp v ;  u>Vr t C t|Bp s   _^[USVWugu Z;u |B;X tB;X tB;X t xB;X u]ދuVS uVS  uVSI  uVS  uVS _^[fU}~h uhCAzfUSV]C"u S%C !$HAC @u)+5`JA׃sGS ;uCA EȋPhCA׃s S ;u DA EȋPhDA׃hs S H;u DA EȋPh*DAg׃C t&;u2DA EȋPhEA*׃hBEA׃Ws SI _^[hHEA׃hREA׃F;s|Ws S _^[h\EA׃hjEA׃F;s|Ws S _^[htEA׃hEAo׃F;s|Ws S _^[WS6_^[Ã{tWssl ;uEA EȋPhEA ׃Ws S; hEA׃_^[S_^[hEA׃Ws S _^[Ã;t0;uEA Eȋ tShd*^_^[Ws S _^[WS_^[hEA^׃Ws S _^[_^[hEA:׃_^[STPhEA׃_^[ÐUSExuhEA׃[hEA׃EX t]E P<;uEA EȋPhEA׃E Ps s hEA׃[ uu hEAl׃[ÐUS]EPEPS |B;X tCuxhEAs 5 td} |}~~uhFA ׃EPhFA׃} |}~~uhFA׃[EPhFA׃[Ã}~}uuhFA׃[Ã}|uuh*FA׃ [uuh4FAt׃ [ÐUSh>FA\׃EX tY;u@FA EȋPhJFA.׃[ t.f;uNFA EȋPhXFA׃[ uh^FA׃[ÐUSExFh*=h*}hd*h(/׃d*d*ܱ(EX fCtBt tu th`FAe׃"hfFAV׃CP5xJA;urFA EȋPh|FA׃E@uhFA׃1hFA׃hs S {t hFA׃[ :h*=h*}hd*h)!׃[Ëd*d*ܱ)[fUSVWuCuWsqEPEPV FuhFAs :  t E+E@ +_^[ÐUSVW]C"u SC Q!H$IAs _^[S tASEs GuWuxWuv_^[s ]_^[s e|B;x tGuAhFAw 8 t-SE)@5@uhFA׃ _^[SNg_^[S_^[S_^[Se_^[hFA׃_^[S_^[Ã@@0VhFA׃_^[Ã@@0 uhFAd׃_^[VhFAQ׃_^[Ã@@0 uhFA-׃_^[s  thVw_^[VhFA׃_^[SSPw_^[Ã@@0V uVhFA׃_^[Whd*$W_^[SB_^[C r C"vCPhFASMPhFAP׃_^[fU SVW@EE@)@@@0@EE@Ep ؋ExuF|B;X tCu$hFAs  thVv=hFA׃.E@؋ @FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u_^[Ë 6=pMA.hDE lMA@ElMApMApMApMA lMA<} tE,u׃@Eu膉u7ux EGE8_^[ÐUSVW5lMA t@VR׃+ u+ہ }fhCCÁ |lMApMA_^[ÐU=dC|5dC5dNA@dC 0B CdCE0B=0Bt(E8uMA EEȋP5|NA}ÉUS]=0BucK!0B@ @c % C0BC S9[fU0B@ t0B@ u 0BH=dC5dC5NA舋dC=0Bt/0B8uMA0BEȋP5NA׃dCC0BfUuE0BfU0B;,At+0B;,AuUhSVWhMAu ׃0B=0Buu5NAw50Bhh0EP׃f} tJf}tBf}t:f}#t2\A\A TA@=TDCu"=4Cu\FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^  t%hu50B׃ uj+聺=l.B=MAtY=-Bt50B膮-B50BsP2hhMAXPKPR&=-Bt -B@-B-Bp50Bx׃_^[ÉU=Cu+50Bhhu׃ u5C5$OA,CfU=Cu+50Bhhu׃ u5C5FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u+ۋ[ÐUSVW} hu=MAEEVЍ5MA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uMAG0BG  V6 1h5,AVB ؋GCGChsS賰 SP=0BS,>EEVMA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u-hC_^[GuVW_^[VWe_^[ÐUSVW] S t3;u(F u~ t+E@GG u_^[Ëv$ uSu_^[US,A@ P5,Au  ؋E@C=0Bt S<[USVW}.u|GTus%hWPfN0BF,A@ f % F,AF E @FE @FL_^[ËE @ ~%u G_ hWwء0B@ P50BS E @FE @FhvV VMN_^[hWء0B@ P50BS E @F_^[fUSVhuV؉ t-;3u C ;,A t C u[$ uhViء-BCcK,A@ c % C\ACSXM=0Bt S:S^[ÉUhSV=hChC׃-Bl.Bk -BM l.Bk -BMHl.Bk -B p.BHl.BÐUSVu ]=hUCtVS5lOA8׃ =p.BuACCPw-B-B-Bpp.B^[áp.B;Cr*CCP5-BR׃-Bp.B -B;u!=hUCVS5OA׃ ^[áp.B -B;tu?=hUCt!VSp.B -B45OAE׃p.B -B^[áp.B -Bp.B -Btp.B^[ÐUhAhA"o0Bd>Ph50B8o HQPh50Bo =Ph50Bo ^Ph50Bn d`Ph50Bn DaPh50Bn TaPh50Bn XaPh50Bn \aPh50Bpn daPh 50BWn h AhAn@UCd>Ph5@UC'n HQPh5@UCn =Ph5@UCm ^Ph5@UCm d`Ph5@UCm DaPh5@UCm TaPh5@UCm XaPh5@UCxm \aPh5@UC_m daPh 50BFm CfUSV]u ;P3Bt ;`3B u ;0B u ;0B u ;0B u ;B tY;5P3Bt ;5`3B u ;50B u ;50B u ;50B u ;5B  u);X3Bu;5|Bt ;5X3B   u);L3Bu;5L3Bt ;5xB   uy;T3Bt ;\3B u;Bt ;B  t9;5T3Bt ;5\3B u;5Bt ;5B    u,;pBu;5|Bt F ;|B   u,;tBu;5|Bt F ;|B  ^[U SVW]u CUFHs 觿v 蚿E;=P3Bt ;=`3B u ;=0B u ;=0B u ;=0B u ;=B tkE;P3Bt E;`3B u E;0B u E;0B u E;0B u E;B  u; u;] u?;=X3Bt ;=|B tE;X3Bt E;|B  EEE_^[SVW\$t$;Bu F uCu ;5B _^[ÉUSVW]u +Cu F tv ٽ; u2Cu F ts 襽; _^[ÉUS]Cus q;|B[fUSVW]u +S t F t5|Bv   Vw tNCu5|Bs K  t S&EVM;  u1~t#CuF@;C    uHV u C tv >;|B t{ _^[ÐUSVWuu ;ueVS uVS  uVS`  uVS  uVS0 _^[ÉU}~)h uhA=@t-Bd*P.U SV]C"u SC &$AC @u;+5A׃s@@0hA׃;u"A EȋPh,A׃s财S'g;u8A EȋPhBAK׃hs S -;uNA EȋPhXA׃;udA EȋEhhnA uvAhhAEȋM;u5A׃;uA EȋEhhA uAhhAeEȋM;uhAC׃6hs S ;uA EȋPh°A׃hs Sf ;uڰA EȋPhA׃C t&;uA EȋPhA׃$;uA EȋPhAn׃hs S P;uA EȋPh&A4׃hs S hSS +;u׃S (;uA EȋPhA ׃SN hA׃hs SX ;uA EȋPhʱA׃;uԱA EȋPhޱA׃hs S x;uA EȋPh A\׃;u*A EȋPh4A8׃.SP;uBA EȋPhLA׃ t7h*=h*}hd*h;_׃d*d*ܱ;h*=h*}hd*h (׃^[Ëd*d*ܱ ^[U SVWu F"u VAF $$AVPh\Aj_^[ËF thpA׃)F txAAPhA׃~Gu)?uA EȋPhA׃F u@GuWkGuuWEkhAJi~G uhƲAh5ȶAi  uhAh5Ai wh A׃v FuhA׃hA׃Fu hA׃>uA EȋEEV$A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uuv Vp _^[uh.Ahd*޿׃ _^[uV)_^[uV_^[Ã~tuvv >u2A EȋPh>ufA Eȋ tg uhpAhd*蹾׃^;5,AuhzAhd*蝾׃B>u|A EȋEuhAhd*m׃ _^[uv V _^[uV_^[hA;׃uv V _^[hA׃uv V~ _^[_^[hA׃_^[hA׃_^[ËFPhA׃_^[FPhA׃_^[ÐUSExuhȳA׃[hԳA׃EX t]E P;uܳA EȋPhAA׃E Ps s hA׃[ uu hA׃[ÐUSVu ExuhA׃^[hA׃FPYhA׃EX tYfFP3;uA EȋPh At׃FPs s h&AU׃[ uVh*A8׃^[USVW} uh.AhK5Ad _w;=X3Btw ;X3Bu` |~~ShPA׃PhVA׃ |~~Vh^A׃_^[ËPhdA׃_^[ ~ uShjAq׃_^[ |VShxAY׃ _^[VShAE׃ _^[UShA,׃EX tY;uA EȋPhA׃[ t.f;uA EȋPhAп׃[ uhA輿׃[ÐUSExh*=h*}hd*h(׃d*d*ܱ(EX 1fCtettt%u>t-hA0׃@hA!׃1hA׃"hƴA׃CP5AbCtu_t7;uҴA EȋPhܴA躾׃hs S [;uA EȋPhA胾׃5;uA EȋPhA]׃hs S {t hA9׃[ h*=h*}hd*h)艴׃[Ëd*d*ܱ)[fUSVWuK)@@EhA=@t-Bd*P襸׃EXS袻CEsE=HA=@;uA EȋPhA=@t-Bd*P8׃ SE@[ u)h$A=@t-Bd*P׃Vh(A׃_^[U$SVWEp W5؋E@E5@u)@E@ tÉE䡨@Eh*=h*}hd*h(ղ׃d*d*ܱ(G tGt GuB*AEh*=h*}hd*h z׃/d*d*ܱ }t ,AE .AE@;5@r>@+;Ethd*u襶׃uSWf E@;5@sċE@EEV2A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u7h*=h*}hd*h !׃d*d*ܱ h*=h*}hd*h)׃_^[Ëd*d*ܱ)_^[Uhu謲PuÉUSVW]C"u SC &w$LAhu s _^[ËC @uC @ @uS_^[hu s r _^[hu s Z _^[S_^[Ã= @t"h \z@p 50z@h; SS>_^[Ã= @t"h\z@p 50z@h:8=dAt S_^[uS_^[Ã@@0 u)h>A=@t-Bd*P}׃_^[VhBA=@t-Bd*PS׃ _^[Ã= @t"h\z@p 50z@h9]@@0 u&hHA=@t-Bd*P׃%VhLA=@t-Bd*PƲ׃ =_^[Ã= @t"h\z@p 50z@hO9XEE )@u EP5@|\ s կtut eeSuu6<_^[Ã@@0V u*VhRA=@t-Bd*P׃ _^[Ã?u^A EȋPhhA=@t-Bd*P譱׃ _^[S_^[S_^[SW_^[C r C"vCPhlAZS PhA=@t-Bd*P-׃ _^[ÐUSu u}tAAPP蚹׃.u-PhA=@t-Bd*P輰׃ p-u9.u-PhA=@t-Bd*Pw׃ +PhA=@t-Bd*PJ׃ hePrZ tE[h.PRZ u$hA=@t-Bd*P׃[USVu ];5xBt;5L3BuT t(hA=@t-Bd*P襯׃^[hA=@t-Bd*P}׃^[v 膢@uv rPS3^[;5X3Btv Q;X3B0hA J t)ShA=@t-Bd*P׃ ^[Ã}tP)'^[Ã=@t-Bd*܃@x}&=@t-Bd*Ph'׃!=@t-Bd*܋'P&=@t-Bd*܃@x}(=@t-Bd*Ph'訩׃^[Ã=@t-Bd*܋'^[hĵAv  t6]EEPhȵA=@t-Bd*P׃ ^[Ã=lAt)Sh̵A=@t-Bd*P腭׃ ^[Ã=hAt)ShҵA=@t-Bd*PS׃ ^[Ã~|)ShصA=@t-Bd*P$׃ ^[ShܵA=@t-Bd*P׃ ^[US]{{}{ uhAh5(AjU {u'@@]huuh [Ã@@MHMhuu; [u SSsP^ [USVu ~:ƃ@@V ~&PhA ׃@@0^[ÉUShA۰׃u?PhA走׃[ÉUSVWu Ep 蟞؋C 8C EV A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u+hA=@t-Bd*P薪׃)=@Cu S#Cu VS5@A}RhA=@t-Bd*P5׃_^[ÐUSVW@E@@3?uA EȋVhA׃uHM+ȉ @_^[ÐUSVW@E0+EXE ƃ }tDE;u"A EȋPh,A=@t-Bd*PB׃ ;;u0A EȋPh:A=@t-Bd*P׃ Gǃ | +EE0[ N_^[ÐUSVWE@E+à }t[E} t'Wh@A=@t-Bd*Pu׃ yWhFA=@t-Bd*PN׃ R} t'WhJA=@t-Bd*P!׃ %WhRA=@t-Bd*P׃ Fƃ| +EEGNjE;x_^[fU SVWEpКFt:Ft1Nuh*hXAh*}׃O;}] CEpnEFuvWEBEuu訫 u?LN5XAh*׃uh*`hjAh*׃jNuWh FuF G|BG[ v 这 t tF)F u tCFt Fu1 t-M5pAh*M׃uh*M_^[ÉUSVW}EEu*CuECEE BsEC t s 3EPEPur ;}|;}~0h~A@ u@uuW5AM@@+MM H_^[ÉC+f+Ð+ÐÉT$D$ tft t"=H3Bu;P3Bt;0Bu+;|Bt=H3Bt =H3Bu;X3Bu+;Bt=H3Bt =H3Bu;T3Bu+;Bt;\3Bu+ÉT$Bt B%uB tHABAÉUE;,At3uPhRA׃uhd*h`AÐUE;,At3unPhbA٨׃uhd*PhnA輨ÐU5A諨׃uhd*"huu PhrAr׃u hd*h|AUÉUSVW}E8G EV~A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ G EVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u EE5A訦׃G hAw 薧 w V舟 w mC t CEuuuV/w h*=h*}hd*h z׃#d*d*ܱ 5,Aإ׃hA˥׃Whd*DhA谥׃_^[fD$8t D$8tD$%+USVW} uHPHE u FIu1 t+hA'׃Ep u  DžDVr=dAEuEE+V. uCDt hA蹤׃=-Btu V u V DžDv  ~W~Ext hA]׃u +P!PhA9׃ ~hA(׃hA׃_^[USVW]+C ucCtC%t C uH;uA EȋE.t's ő tFt F t_^[fUSVuv 艑Ctttttas V5|BS豢 tu Vi^[Ã>uA EȋPhĺA׃^[Ã>uкA EȋPhںAҢ׃^[u V ^[ÉUSVW]S2 t3SIPh tShd*hAr׃$;uA EȋPhAL׃S~ t7S) u*hu S褔PӚ@@0u SS`EC tu S~Et EuC t}tWu VS6s  _^[W蝚 C tA{};5-B t)hSfPEP Wu WVݙS0 tS _^[s { _^[5DA׃_^[USVW}uhAh5\AlD E0 u( uA t?u+ۋ_^[ÉUSVu] uh(AVW׃^[;,Auh2AV=׃^[ u S跢 tSV1^[Ã;u4A EȋPh>AV׃ ^[ÐUu 莐PuE 8uBA E EȋPhLAu衚fUSVW}} uhPAh5tA,C E SrVWvv$ t:;u/G}Wh 轕׃  VW<v$ uƃG}Wh 臕׃_^[Ë _^[ÐUSVu tJV苏 t;,At Su>utA EȋPh~Au薙׃ ^[fUSVu uhAh5AB ~t F;4.BuhAe6^VhS7Ѓ^[fUS] S5A׃;uA EȋPhA׃C tAлAPhһA׃s6PhֻA詝׃C PhA蒝׃SPhA{׃SEVA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ t)C tA APhA蚜׃C tA"APh$Aq׃C t(A:APhFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ;u:A EȋEVЍ54A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u=@@0VhDA[׃@@0VhLA?׃_^[Ã{t C;4.Bu&ShhRA)+P,Ѓ_^[Shs,Ѓ_^[USExu5A5hVA=@t-Bd*P褍׃u )@EX t8SZ[ t&hXA=@t-Bd*PS׃h\A=@t-Bd*P-׃[fUSVW}?u^A EȋPhhA=@t-Bd*P׃ @E_w=A@W7E@_^[fUSVW@Eu)@@EEp SԉhnA=@t-Bd*P:׃C tCt Cuo=pA=@t-Bd*܃@x}&=@t-Bd*Ph W׃)=@t-Bd*܋ =rA5@@;Ef@+;Et =@t-Bd*PWq׃=dAt%E@ @ @uE@ p  SƍE@@;EE@VvA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ug=@t-Bd*܃@x}&=@t-Bd*Ph 蝅׃!=@t-Bd*܋ hxA=@t-Bd*Pԉ׃_^[USVW}] Gt!W|MWM_^[uuuSw EPEPw6 E+EF uMUEU$MEEM EU f_^[ÉU}tuu hzAP蕑׃uu hAPy׃.u-PhA=@t-Bd*P蛈׃ p-u9.u-PhA=@t-Bd*PV׃ +PhA=@t-Bd*P)׃ )܃ u)@ x'A  u9h.P2 u!hA=@t-Bd*P軇ÐUS] =@t-Bd*܃@x}&=@t-Bd*Ph\׃!=@t-Bd*܋\=@t-Bd*܃@x}'=@t-Bd*Ph0耂׃[Ã=@t-Bd*܋0[à =@t-Bd*܃@x}&=@t-Bd*Ph\ ׃!=@t-Bd*܋\=@t-Bd*܃@x}'=@t-Bd*Phn袁׃[Ã=@t-Bd*܋n[ à =@t-Bd*܃@x}&=@t-Bd*Ph^ ׃!=@t-Bd*܋^=@t-Bd*܃@x}/=@t-Bd*PÃAP豀׃[Ã=@t-Bd*܋ÃA[à |pÃ~h=@t-Bd*܃@x}&=@t-Bd*PP0׃[Ã=@t-Bd*܋[PhA=@t-Bd*Pa׃ [fUDA;@ADAE u+:E u+.E )D)܋ )I;)@Au:EPhA=@t-Bd*PŃ׃ DA@AÃ=@Au @A=@A2E =@t-Bd*܃@x}&=@t-Bd*Ph\~׃!=@t-Bd*܋\=@t-Bd*܃@x})=@t-Bd*Ph0_~׃=@t-Bd*܋0E =@t-Bd*܃@x}&=@t-Bd*Ph\}׃!=@t-Bd*܋\=@t-Bd*܃@x})=@t-Bd*Phn|}׃=@t-Bd*܋nE E =@t-Bd*܃@x}&=@t-Bd*Ph^|׃!=@t-Bd*܋^=@t-Bd*܃@x}2=@t-Bd*PEAP|׃=@t-Bd*܋EA=@t-Bd*܃@x})=@t-Bd*PEP |׃=@t-Bd*܋Eh=@t-Bd*܃@x}&=@t-Bd*PEP{׃"=@t-Bd*܋EDAfUS] uK=@t-Bd*Ph\׃=@t-Bd*Ph0׃[à uK=@t-Bd*Ph\׃=@t-Bd*Phn[׃[ vR sM=@t-Bd*Ph^+׃=@t-Bd*PCAP׃[É)܋à u)5)F{׃@ x'A%W t#=@t-Bd*PS~׃[ShA=@t-Bd*Ps~׃ [ÐUSVu ];5xBuT t(hA=@t-Bd*P1~׃^[hA=@t-Bd*P ~׃^[;5|Bt;5`.Bt ;5X.BhA t)ShA=@t-Bd*P}׃ ^[Ã=@t-Bd*܃@x}&=@t-Bd*Ph'x׃!=@t-Bd*܋'P=@t-Bd*܃@x}(=@t-Bd*Ph'zx׃^[Ã=@t-Bd*܋'^[hƾAv ς t6]EEPhʾA=@t-Bd*Pv׃ ^[Ã=lAt)ShξA=@t-Bd*PW|׃ ^[Ã=hAt)ShԾA=@t-Bd*P%|׃ ^[Ã~|)ShھA=@t-Bd*P{׃ ^[Sh޾A=@t-Bd*P{׃ ^[ÉUSE Xf tC@;Et[ t>;uA EȋPhA=@t-Bd*Pd{׃ [uhA=@t-Bd*P:{׃ [USVWEhA t,uhA=@t-Bd*Pz׃ _^[Ë]+ hSEP }u-u5 A=@t-Bd*Pz׃ _^[Ã}ut} tn=@t-Bd*܃@x}&=@t-Bd*Ph"u׃!=@t-Bd*܋"E+fD5 u,';)uD5P3D5PFƃ} t } tp}tj=@t-Bd*܃@x})=@t-Bd*Ph"t׃_^[Ã=@t-Bd*܋"_^[ÉUSVW]} t:E p&E4CuSE p E@PFƋE ;0~_^[Ë=Xz@+;u}Xf4ChA=@t-Bd*Px׃ 4CWS+ @@8[ F;u|SvPWCvh A=@t-Bd*P_x׃E $As s @@0Ta @s G]ukE@@Eu)hA=@t-Bd*Pw׃E@t E@u:hAEp } t#E@;4.BPu(uhA=@t-Bd*P0w׃ |=dAt @s X\C"vCPh"As \t)@s Ph:A=@t-Bd*Pv׃ h@A=@t-Bd*Pv׃_^[ÉUSV]s iC ;xBthBAs g| tSSmwP^[ËC ;|BthJAs 1| tS@@P^[ËC ;BtFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uYtP5WC{׃t%P5TNA{׃t $;E|1TDC5FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ E TNAEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uh&5Ahh׃ #}=Dh*=h*}hd*h O׃d*d*ܱ 5A^[ÉUSVWE Xh;tE@ t5AX׃uhd*bE@ uh(A uu u3S>& Vh0AX׃S#Ph:AtX׃=Att=-Btk-BESX#-BhhmPVhmPhEm WI.E-B_^[ShDAW׃_^[ÉD$-BAUSVW=Au15-B t3DCAA* DA*_^[fUSV5-B t#h蓖h-B^[hfh^h-Bh;s u^[ÉUSVW5,A uhNA_^[Ã=-Bu5A_^[+-BE+ u5A;}|bE-BDCAA·ѹ*󥗇-BA5A5-BA.E;,AuhdAEPVxG D_^[fUSVW5,Ae uhzA_^[Ã=-BuhA_^[+DEPS=Au35-BdEDCAAMѹ*󥗇E;-BuAK;H u}tEPSFɃ}t;u}hA_^[ËE+DEPS7+;}9EPSF  uhAh5,AC G;|ɋE죸-BAˇѹ*󥗇-BA5A5-BA_^[USVEXS.S" u;LNAsC;LNAu^[ÐUSVW-BSv.4LNA4>AfS^" u ;sC;s St_^[UShhAhP= u5DAD\t=5\Ah*M׃Vh*shAh*M׃> uhAh*5tA ^C t C  u C u C u$;u A EȋPhAE DE DX4B DHC-BuSWSFShbegPlP5-BhHgP5-Bh4gPh+&g Ph -B u-Bh_^[ÉUSVWu} }tc u95Ah*K׃+Cvw gP u1 ?u8A EȋP5Ah*K׃ +  WM w zM >t F;lB u,>huF8tF@;lB   u:[5Ah*K׃Vh*qqhBAh*J׃+ۋ_^[fU,SVW}@EEEGEVDA;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ (=H3BG  EGEtEE@E}uEE܃fEE;E}B}u_u ([v >  uhLAh5A) E؋E;E|FEuSu- uF?upA EԋȋP5Ah*'I׃ E죨@XCSuEE}3_u G  Eu >  uhzAh5AQ FEuSu` uF?uA EԋȋP5Ah*ZH׃ E죨@XCSu t[Ev ^}t6 t2E죨@?uA EԋȋP54AE_^[ÉUSV+] t9;  uhAh5LAY s"FƋ[ uɋ^[fUSVW]'= DYC;4.Bu0.BCEuFx5dAh*4G׃;uA EȋPhAh* G׃ Ex,5|Ah*F׃;uA EȋPhAh*F׃ 5Ah*F׃hC EEuQh 50.B7 MA,hs }9Ph uЃ u*hs S9Ph uЃ tEEEEs lC}tLuuhV?VE)5@Vu5@ uh_`8uuhV= @us FPh%`#= @C G5 Dio Dχѹ󥗇W@E׃+5 DN vh*=h*}hd*h k@׃d*d*ܱ Shd*R;uA EȋP5AI׃> _^[ÐUVW@@ -BH@@ -BH@@ -BH@@ -BH@@ PDCH@@ -BH@@ AH@@5DCX*@ @5 Dx@@Eh:MA@@EhMA@@EhMA_^ÐUSVW@@0h @@0h@@0h@@= D@X@=DC*@@A@@-B@@PDC@@-B@@-B-B@@-B@@-BS$_^[S\$  @DT$C u[US< D@D+ہ}< DCÁ|hAhhAhhAhwhAheD*ܣDDLUCfHUCBHDB-B[ÐUS5DDh(hB@׃ MBHDE8t+&=Aul=WCuDD@PC׃ tFh*=h*}hd*h G<׃d*d*ܱ DDf`+5DD@׃AAi(PDDDAi(TDLUCAi(fXDfHUCAi(\D t>Ai(\DPhBH׃MAi(\9DHD+ۋ[ÐUSVW5HD =WCuDD@P@B׃ t=-Bu5\4Bh AD׃=-BthA5-Bn?׃hd*>׃EP  u}uS5HD';) uV u5A4 @D<uFE-BPz@ @D<uF5HDHDLDء@D<ue=Pz@u Pz@Lu8F"t F'u"HDhFP5-BY @D<u{=Pz@u Pz@=EtS2u9HDHD>u RHD)HD5-B 5-B J >HD=Pz@u(u =Pz@u Pz@Ã\|~L"|  w$lA@e` HUC fHUChS<=EtHD5-B nHD.uHDUQHD @D<uHD *. =EtHD5-BHD>uHDT-=WCuDD@P>׃  u5HD fHUC#F uzB+ȸ(+E~W5DDuV;׃ u+B';) uV! u5A5HD-\=Et5-B{\=EtHD1uHDS&fHD @D<uHDHD[u HDVs]l+h=Et+ShA  uHD5-B4=Pz@u(u$Pz@=Pz@u)u Pz@-B_^[ÉUSVWuV\C׃EB HD+ȋ;}|.+EBHDHD CF HDf tCE+ljEE -B;r5AfE ;HDtB t CF BHD_^[ÐUS]:E tJ u5A.)u5Aw,u54A_C믋[ÉUSVWEP"HDf(t" @D<t5LA CC+E;~Qh,S6CÃ=HNAu 4e=HNAu 4eGNjE;Eh)S=HNAuE4Me=HNAu 4_eCHD_^[ÐUSVW}uu _^[Ã}u+ ExȋPu f ;r hA @D<fGF  @D<t @D<tDžDž}u+ExȋA||;|u+|xȋ|u+|xȋA|u8AxȋtV;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u Dž|t<f CG CF P3_^[fUSVE dAEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ LDB+ȋB;s#f @D<uB;shBhBAh*p4׃ th VhFAh*T4׃B;u5|Ah*74׃5Ah*"4׃^[u2^[fBHDBÐUSVWHD=Et/f\uCFC PhJA t(FC  @D<t @D<t؉HDhPjMTB}VPP5TB HD @D<uHDHD @D<u uh~hj=Et OWhO5TB=Pz@5O)=HNAu-PQ_hPILTB=HNAP?_hPLTB=Et O5TB t IhO5TBOum=Pz@ud=HNAu*P^hPKTB1=HNAu(P^hPQKTB=Pz@ut Pz@=Pz@u Pz@_^[ÉUSVWHD0unCxuHDDžCtuHDDž mhPA t DžPDžDhXAX t Dž'h`A; t Dž Dž u< @D<t a|f~A|TFLFC Ńu0|/7'FC  @D<u FC .C.FC  @D<tetEtdtDuDC+t-t @D<u"FefFC  @D<tP,׃TBNt"tuDt,P+׃TBJPQTB4PgTBhhAh5A.LHD_^[ÐV+T$fƍ Ѝ4B u^+ɋT$Ha|f  %A|F  B uÉU(SVWHDDž';)nf\uBC u75DDh(hB*-׃ u5ABb t u5AXDž9:Eu Dž&HDFSHDCÃD u+8 u+- )D)܋ )I;)uM\uEC u:5DDh(hB,׃ u5AkBu, t u5 A9Džu:EuDžHDFSHDF u+>F u+0F )D)܋ )I;)~5CÉHDFS0HDǃCÃeHD';)uq} ukE'u% uTBDžMPP3׃@PP3׃TBDžPrE'P3׃ u+@ u+1 )D)܋ )I;);t5$AN} u@)@PPhTB-׃ u5FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ V\A;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u"hVEPhd*hD*S_^[hVhd*hD*Sa_^[ÐT$ t uBʐ tB uŠ:uAÐU SVW=-Buh`Ah*׃_^[á-B;At=Eu"5-BhpAh*׃ _^[u :EtEE t;hudGA=Au膾5Ah*B׃_^[Ã=Au`50Ah*׃_^[E=E(AEfE/uEE;E~EE}}EEhE=xAE쉕=xAE4W׃ G} W׃؉ t*t%FG} W׃P5AUE}uE;(A}u65HAh*׃_^[Ã=-BuuuEhh~0Puhm0PhE_0 E(A_^[fUSVWu }=-BtA:hhAY/PEur@@Ù=|AM+ȉ}=Et;E~E=-Bt3+;+++ȋ=|A+ȉ_^[ÉUS=A8hO虹hOS衾 AO AAAAk( A[U8SVW]A ~ShA_^[E} +Eȋ }EDEȃ} |Eԋ4E ;ttt؍G_5AuV50B5A}E;]~Et\zE;]hd* ׃h׃ v$ Eԁ} >_^[ÐUSVE8u6A EEȋP5 A׃+ }2fE tC ;Eu Sy[$ uFƁ |^[ÐUSVW5 A tOV׃+ u+ہ }fECÁ | AA_^[ÐUS؋E4.BCKE c % CEc% CEC EC[ÐUSVE%Q؋EEC$E^[fD$%ЋD$L$D$ EH$D$EÉSV+ }LE t6C t C  tC;D$ u^[Ë[$ uFƁ |+^[f WL$T$%D$D$FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ ^[USVWu u*h$Au VhW腗ЃF~t F;4.Bu+1v  tu Vhv=Ѓ؋_^[USV]3i t0;t%;u;s u F u ^[Ëv$ u+^[ÉD$@;4.Bt6D$@;0Bu\.BhD$@;0Bu`3BQ\.BID$@;4.Bt6D$@;0Bu\.B#D$@;0Bu`3B \.BT$ fUSVW] k$LACC_^[áBC_^[á|BC_^[áBCXC_^[sj C_^[s C_^[ËsvGt>h(Ah*׃Vh*1h*Ah*׃;G @uFCv@ C_^[ËC @C_^[ËsFC>F@ t C@ uFCFC_^[ËF@dFKFC_^[ËC@C_^[Ësv@ C_^[ËC @C_^[áBC_^[ËCx5BW8 uY5BW% u@ɜh>Ah*׃sh*h@Ah*d׃{_^[ËCx5BW u>bhTAh*׃sh*whVAh*׃聜{_^[hS&_^[5xBS_^[ÍCPC P5BC pPCpPe C_^[ss 5BC pkPCp\P C_^[s xBC_^[s s xBC_^[áBC_^[ËsvBC_^[C_^[fU SVW]s{ vEwE5BuE5BuE5BuE5BuE}u}tN@}u}uVh C}u}uWh C BC }u}tK@}uVh~ C}uWhg C } uBE C_^[v~?謙5HAh*h׃Vh*hjAh*H׃̙ew~>]hlAh*׃Wh*thAh*׃~5Buu C} tE C_^[USE5Bs5 tSh[ M[5Bs  u5`A蘙[ÉUS]5Bs u5xAi[fUSVW]C@ t C@  u C@ u C@ RCEE}u f t-;E u G ;E t G  u$ tE@$E fE@$E}t]E@ t E@  u E@ u E@ t E;E t}t }, uE#} uA E EȋPhAh*׃ sh*CT;h豔~~vE@uEp u `uu N uC|} uA E EȋPhAh* ׃ Sh*z薖E@uv2tTV4 C@ u8hhFpvZ@@0h[ WhK PVh < Vh, _^[USVWEpl؋C E}u CuhE}  E p> u<5Ah*׃|V*uSPhPVh~ Wuhk EGE @ E tQu؋C EE pCu}*CuWhE5Al} #*CXhAh*׃uh*mhAh*׃wFE8 uEpEp  uuWh ^ C Gv [ t Ct uCukhAs z uW蒓 thAh*K׃5Ah*6׃uh*hAh*׃蘓_^[ÐUSVEp ؃{t C;4.Bu*u uhhAP|Ѓu uhs]ЃVhH^[ÐUSVu؃{t C;4.Bu-uu uhhAaPЃ uu uhsډЃ ^[ÉUS]C;xBt=)h Ah*׃Sh*@5Ah*׃I[ÉUSh5|Bhhh.h5Bhhh CKHC@C@CEuF׃@MA[ÐUSh5Bhhhh5BhhhCKHC@C@CEu׃@MA[ÐUEp׃E@fUuEu(}uA EEȋPhApYEP uIu t:EPk u*h2A׃uhd*Mh:A׃EÐUSVE0 uh>Ah5Ay SF t^[Ëv$ t!f;uF t^[Ëv$ u^[ÉUSVWEE]E'f;EuDC t;Ct25-B+f t ;s tGNjv t;}} ]}E[$ uE@%uEPEE}'tEMEEE_^[fU SVW-BEʔEE+ t|}tvEPV tcfEf t&;EuC ;EuC t Cu[$ t EE;,AtEPV譏 u_^[ÐUSu X t ;Et[[fD$%ЋD$EUSEpS5B! u[ōhbAh*׃uh* C 8unA C EȋPhxAh*C׃ Ǎ[USV}u ^[u4؋C;4.Bu0.BCSnttCtmhSh V脄Ѓ t ^[ø^[hSh VUЃ t ^[ø^[hSh V&Ѓ t+^[ø^[ø^[ÉUSVW]CEh1EFE t$ACFCFCFCFCF CFCFCF{~CF ?oGE@t E@u1hF F~ ~ t5AYGF#E@E0EE@ ;EtE@ ;,Au4E@ t E@  tEGEGE@$E}uCFCF CFF CFeCFCF QCFCF CFCF+EEKLEEŔTA;EVQVi=3Bt-v vV6P5A׃hd*[׃_^[ÐUSVu>u^5> u.^;u(h藇 F@CFCދ^[fUSVWu>u7^C@ t C@  t VF׃+ދ_^[UE EhM qhhhMAu uhhÉUE@ t%E@ t huO_t 5A謉ÉUSVW] uhAh5A tt>tt,s>u; t vPlBF hvhhhFKIH{G t G  u G u G twh@'WhWPhlBFRlBFFo5Ah*+׃Sh*hAh* ׃S* 膇_^[fUEpuh USShu蛖P. [ÉUSVWE t+uQE x thAuP׃hAu>׃E xuOhAu%׃=E 4ŘTAhAu׃ E ŔTA thAu׃E N@E$AE @8uAE @EȋPhAu׃ _^[ËE x@ E =?c4ExthA`׃ hAQ׃Wu_^[ËE phAu%׃ _^[ËE phAu ׃ _^[hAu׃E puLhAu׃E x u+E @ EȋAE}t\}u+ EEȋ}u+ EEȋAEVu} uhAuZ׃}uE 4ŘTAhAu8׃ _^[u u_^[ËE puw_^[ËE p uaE xt!hAu׃E pu7hAu׃E x~E phAu׃ E phA׃_^[ËE ŔTA t:+ۉE tuCE ŔTA;~hAu?׃_^[ÐU$SVWEEE xu+E @EȋA u+"E xu+E @EȋAE܋ȋ uhAh5 Aq >\~ u+ F EȋA u+~ u+ F EȋAE܋ȋ uhAh58A ?euSh>AuH׃E xthDAu/׃hFAu׃vuyE?dE xtLARAPhXAu׃ ES>duNh\Au׃E xthbAu׃hdAu׃vuE}>_uF xthfAuP׃.}u(E xtnAvAPh|Au ׃ E xu+E @EȋAE}t\}u+ EEȋ؃}u+ EEȋAESu} uhAu׃}u_^[USVWu] ;wv35PA!ǃc|tg 7$A{uA CEȋPhAV׃ _^[sV=_^[Ã=l.BvsVMhAV׃C@-BC @-Bs V_^[Ã=l.BvsVhAV׃s V_^[Ã=@t)hAVe׃hhsVw_^[shAV9׃ _^[shAV#׃ _^[s shAV ׃_^[shAV׃ _^[shAV׃ _^[sV5hAV׃s VhAV׃_^[sV{ hAV|׃s V_^[sV_^[sV{ dhAV6׃s VhAV׃_^[sVshAV׃_^[sVTC @8uAC @EȋPhAV׃ _^[s VhAV׃sVhAV׃_^[TAt7uXsV4TAhAVG׃ s V_^[4TAhAV!׃ sV}_^[Ã׃ t+_^[+ }L(FGǃ |u u^EEE+ }Cf@T@f@~@@@Ȃ@@@@.@T@l@|@@@@փ@@@@4@L@^@r@@@@„@Ԅ@@@"@0@D@h@x@@@ԅ@@$@L@h@@@Ԇ@@@,@P@n@@@@̇@@@(@H@`@t@@@@@@Ј@ވ@@@@4@H@f@@@@@Ɖ@։@@@@&@<@V@p@|@@@@@Ԋ@@@@8@F@R@l@~@@@@ȋ@ڋ@@@.@H@\@p@@@@ތ@ @L@t@@@@ҍ@@@@ @@4@D@X@z@@@Ȏ@@@@0@Z@t@@@Ώ@@@*@J@n@@@@@J@t@@@@@ޑ@@@(@>@R@^@j@~@@@@ܒ@@@*@<@`@~@@ʓ@@@@:@P@d@r@@@@Ҕ@@@@,@>@T@t@@@@@@Ε@@@@@(@:@L@`@r@@@@@Ж@@@@$@:@P@f@t@@@@ė@@@@,@:@Z@l@|@@@@˜@И@@@@6@N@d@|@@@@@ę@֙@@@@@$@4@F@V@f@x@@@@@Ț@֚@@@@@&@8@F@V@f@t@@@@@ƛ@ԛ@@@@@*@:@L@Z@l@z@@@@@Μ@ޜ@@@@@0@B@R@`@n@~@@@@@ҝ@@@ ,6  Q s  OOm,Jt=Yj{9`r,]~=pH{ 8c>j A_',6,6Rap,6,6"Z0h)Jku,6,6 @ s ,6,6 !1!R!p!!!!!,"n"""#1#f###### $A$Z$$%.%=%N%_%n%%%& &Q&&&&''R''''(F(z(((((%)K)q))))))*"*1*B*e******\+++++ ,,,M,,,,%-U-|-----.B.c..../Z/x////060\000001@1f11111$2J2p222222333334%44444 5)5G5n5555555 66F}@L}@P}@T}@\}@`}@f}@l}@r}@ x}@ ~}@ }@ }@ }@}@}@}@}@}@}@}@}@}@}@}@}@}@}@}@}@}@}@ ~@! ~@"~@#~@$~@%~@&"~@'(~@(0~@)6~@*<~@+F~@,L~@-T~@.X~@/`~@0d~@1h~@2p~@3v~@4~~@5~@6~@7~@8~@9~@:~@;~@<~@=~@>~@?~@@~@A~@B~@C~@D~@E~@F~@G~@H~@I@J @K@L@M@N"@O(@P0@Q8@RB@SL@TR@UZ@Vd@Wn@<p@=r@>t@!v@+x@-z@~|@X@*@/@|@\@]@(@[@.@^@>t/<=>!<=>!<=>!<=>!<=>!<=>!<=>!<=>!<=>!<=>!> ;}  7 x A <p<x<x<<Q@ x NxnN D<<<<<<<X<<h[< h< N  uN N 4Nz <<++<<N<<X<<<<<<<<<<<<<.TA <<< \<< <<<   <- xRNx&&&&&&&&e <<<e <<e <<  $ c e e e e e e e   < *  tt %'(),/124589t<NtWX_apqrsuu    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[YZ !"$&*+-\].0D37:=I LMOyQz{STUV^efg`wwwtt ;?CEHGKPdhimobc #6AFJxRjlnv >BD}~kv@|v      !()*-/0134@<=>?ABDEFG/?'C +567"#89:;.,L.&*-( ;*&ILMNPQ.O      !"#$&'()*+,-./0123456789:;<=>?@ABCDEFGHLPLJKLL*PLP2*+-&~%(ILLPLLLL-..*OP<>R/,=+-*>=[U.^T\:+-,[.^T(:[U.^T\(+-*/&|H<>=!=P:{,V(LP(,,OO&>O>S)O>!(.&LL..&=<>=>==){{{:OO&OOLOO]])]){;})),O/,}P)d~@C<D74{y.[:?=q|35@<#K 0_/)#`Y17^m@4 8<:?=!&$[[XZYU!&p$h4935:= *QTRSP wYYVQWT+R,3SP5QRSTUVWXGIabZZ'(7aE_JB[]A fgFk))^}-l  82uv&g>;Z6zebi>'(xxr>;%"%"6>6eOd\eOjhijklmnopqrstuvwxyz{|}~^_`afbcehijklmnopqrstuvwxyz{|}~^_`afbceehijkmnopqrstuvwxyz{|}~^_`afcehijklmnopqrstuvwxyz{|}~^_`afbcehijklmnopqrstuvwxyz{|}~^_`afbcehijklmnopqrstuvwxyz{|}~^_`afbc]\ehijkmnopqrstuvwxyz{|}~^_`afbcQTShijkmnopqrstuvwxyz{|}~^_`afbcQTShijklmnopqrstuvwxyz{|}~^_`afbcehijklmnopqrstuvwxyz{|}~^Ofehijkmnopqrstuvwxyz{|}~^tOfhijklmnopqrstuvwxyz{|}~^fehijklmnopqrstuvwxyz{|}~^efhijklmnopqrstuvwxyz{|}~fshijkmnopqrstuvwxyz{|}~^fhijklmnopqrstuvwxyz{|}~^fhijklmnopqrstuvwxyz{|}~^efhiknopqrstuvxyz|}~^_`afbchijklmnopqrstuvwxyz{|}~fhijklmnopqrstuvwxyz{|}~fhijklmnopqrstuvwxyz{|}~fhijklmnopqrstuvwxyz{|}~fhijklmnopqrstuvwxyz{|}~fQTRSP45KP@CAB<DMON:?=QKTRSP45L9 :;@?EF6<NM!"#c$%=CDGHIJ*+,-)./70123GIOEJFHL>;L9 :c;@?EF6<NM!"#$%=CDGHIJ*+,-)./70123PO@PCAnB<D@CAB<DMONMON:?=:?=P@CAB<DKPKMON@CAB<DMON:?=@CAB<DP:?=@CAKB<DMONKP:?=@CAB<D:?=MONKGIG_IEJKE:?J=F^HFPH@CAB<DKMNLGLIP>;o@E>;J<:G=IFMNHEJFKHGI:?=LEJG>;IFLEHKJ>;FHGILEJ>;FLH>;LGI>;EJFHGIEJLFH>L>;@@>@F@d@l@@@@(#)commands.y 1.20 AIXD}@State %d, token end-of-file -none- %s yacc stack overflowReceived token end-of-file -none- %s Received token end-of-file -none- %s syntax errorError recovery pops state %d, uncovers state %d Error recovery discards token end-of-file token -none- token %s Reduce by (%d) "%s" (noname)(noname)(noname)%s (noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)(noname)Nested subarrays are illegal.Illegal use of subarrays.Nested subarrays are illegal.XALIASALLANDASSIGNATBANDCALLCASECATCHCLEARCLEARICONTDEBUGDELETEDETACHDIVDOWNDUMPEDITEXPFILEFUNCGOTOGOTOIHELPIFIGNOREINLISTLISTIMODMOVEMULTPROCNEXTNEXTINILNOTORPRINTPROMPTPSYMQUITREGISTERSRERUNRETURNRUNSCREENSETSHSIZEOFSKIPSOURCESTATUSSTEPSTEPISTOPSTOPITRACETRACEIUNALIASUNSETUPUSEWATCHWHATISWHENWHEREWHEREISWHICHWINSWINIXORSETVARDOLLARLINESYMINTCHARREALNAMESTRINGWSTRINGERRDIRECTERRTOOUTARROWDOTDOTBRACKETSREDIRECT<=>!+-~UNARYSIGN*/|\]([.^-unknown--no such reduction-input : input command_nlinput : /* empty */command_nl : command_line ' 'command_nl : command_line ';'command_nl : ' 'command_line : commandcommand_line : rcommand shellmode redirectoutcommand_line : rcommandredirectout : '>' NAMEredirectout : '>' '>' NAMEredirectout : '>' '!' NAMEcommand : alias_commandcommand : ASSIGN lhs_exp '=' expcommand : ASSIGN lhs_exp '=' '(' exp ',' exp ')'command : CASEcommand : CASE chgcasecommand : CATCH signalcommand : CATCHcommand : CLEAR line_numbercommand : CLEARI addresscommand : CLEAR STRING ':' line_numbercommand : CONTcommand : CONT signalcommand : DELETE integer_listcommand : DELETE ALLcommand : DETACHcommand : DETACH signalcommand : DOWNcommand : DOWN INTcommand : EDIT shellmode opt_filenamecommand : FILE shellmode opt_filenamecommand : FUNCcommand : FUNC lhscommand : GOTO line_numbercommand : GOTO STRING ':' line_numbercommand : GOTOI addresscommand : HELPcommand : IGNORE signalcommand : IGNOREcommand : listi_commandcommand : list_commandcommand : MOVE line_numbercommand : MOVE lhscommand : MULTPROCcommand : MULTPROC enablecommand : PROMPT STRINGcommand : PROMPTcommand : PSYM expcommand : QUITcommand : RETURNcommand : RETURN symbolcommand : runcommandcommand : SCREENcommand : SET noexpand_name '=' expcommand : SET noexpand_namecommand : SETcommand : SHcommand : SKIP INTcommand : SOURCE shellmode filenamecommand : stepcommand : step INTcommand : stop where opt_cond '{' actionscommand : stop where opt_condcommand : stop lhs where opt_cond '{' actionscommand : stop lhs where opt_condcommand : stop lhs opt_cond '{' actionscommand : stop lhs opt_condcommand : stop IF boolean_exp '{' actionscommand : stop IF boolean_expcommand : trace what where opt_condcommand : trace where opt_condcommand : trace what opt_condcommand : trace opt_condcommand : WATCH exp where opt_condcommand : WATCH exp opt_condcommand : UNALIAS noexpand_namecommand : UNSET noexpand_namecommand : UPcommand : UP INTcommand : USE shellmode sourcepathcommand : WHATIS lhscommand : WHEN event '{' actionscommand : WHEREIS noexpand_namecommand : WHICH symbolcommand : WINS INTcommand : WINI INTcommand : '/'command : '?'signal : INTsignal : namechgcase : nameenable : INTenable : nameruncommand : run arglistruncommand : runruncommand : rerun arglistruncommand : rerunrun : RUN resetout shellmodererun : RERUN resetout shellmodearglist : arglist argarglist : argarg : NAMEarg : STRINGarg : '<' NAMEarg : '>' NAMEarg : '>' '&' NAMEarg : '>' '>' '&' NAMEarg : '>' '>' NAMEarg : ERRDIRECT NAMEarg : ERRDIRECT '>' NAMEarg : ERRDIRECT ERRTOOUTstep : STEPstep : STEPIstep : NEXTstep : NEXTIshellmode : /* empty */resetout : /* empty */caseon : /* empty */caseoff : /* empty */sourcepath : sourcepath NAMEsourcepath : /* empty */event : whereevent : expactions : actions cmd '}'actions : cmd ';'actions : cmd '}'cmd : commandcmd : rcommandrcommand : PRINT exp_listrcommand : WHERErcommand : examinercommand : CALL lhs '(' opt_exp_list ')'rcommand : DEBUG INTrcommand : DEBUG '-' INTrcommand : DUMP lhsrcommand : DUMP '.'rcommand : DUMPrcommand : REGISTERSrcommand : STATUSalias_command : aliascmd noexpand_name noexpand_namealias_command : aliascmd noexpand_name STRINGalias_command : aliascmd noexpand_name '(' name_list ')' STRINGalias_command : aliascmd noexpand_namealias_command : aliascmdaliascmd : ALIASname_list : name_list ',' namename_list : nametrace : TRACEtrace : TRACEIstop : STOPstop : STOPIwhat : expwhat : STRING ':' line_numberwhere : IN expwhere : AT addresswhere : AT STRING ':' line_numberfilename : noexpand_nameopt_filename : /* empty */opt_filename : filenameopt_exp_list : exp_listopt_exp_list : /* empty */listi_command : LISTIlisti_command : LISTI addresslisti_command : LISTI address ',' addresslisti_command : LISTI lhslisti_command : LISTI AT line_numberlist_command : LISTlist_command : LIST line_numberlist_command : LIST line_number ',' line_numberlist_command : LIST lhsinteger_list : INTinteger_list : INT integer_listinteger_list : INT ',' integer_listline_number : line_number_symbolline_number : line_number_symbol '+' INTline_number : line_number_symbol '-' INTexamine : address '/' caseoff count mode caseonexamine : address ',' caseoff address '/' mode caseonexamine : address '=' caseoff mode caseonaddress : INTaddress : '.'address : '&' expaddress : address '+' addressaddress : address '-' addressaddress : address '*' addressaddress : '*' addressaddress : '-' addressaddress : '(' exp ')'count : /* empty */count : INTmode : namemode : /* empty */opt_cond : /* empty */opt_cond : IF boolean_expexp_list : expexp_list : exp ',' exp_listexp_list : exp BRACKETS exp_listlhs_exp : expand_setvarlhs_exp : constantlhs_exp : symbollhs_exp : lhs_exp '[' exp_list ']'lhs_exp : lhs_exp DOTDOT explhs_exp : lhs_exp '.' noexpand_namelhs_exp : lhs_exp '^' '.' noexpand_namelhs_exp : lhs_exp ARROW noexpand_namelhs_exp : '*' lhs_explhs_exp : lhs_exp '^'lhs_exp : lhs_exp '\' '&' lhslhs_exp : '&' lhs_expexp : expand_setvarexp : symbolexp : exp '[' exp_list ']'exp : exp DOTDOT expexp : SIZEOF expexp : exp '.' noexpand_nameexp : exp '^' '.' noexpand_nameexp : exp ARROW noexpand_nameexp : '*' expexp : exp '^'exp : exp '\' lhsexp : exp '\' '&' lhsexp : exp '(' opt_exp_list ')'exp : constantexp : '+' expexp : '-' expexp : '&' expexp : '~' expexp : exp '+' expexp : exp '-' expexp : exp '*' expexp : exp '/' expexp : exp DIV expexp : exp MOD expexp : exp AND expexp : exp OR expexp : exp BAND expexp : exp EXP expexp : exp '|' expexp : exp XOR expexp : exp '<' expexp : exp '<' '=' expexp : exp '>' expexp : exp '>' '=' expexp : exp '=' expexp : exp '=' '=' expexp : exp '<' '<' expexp : exp '>' '>' expexp : exp '<' '>' expexp : exp '!' '=' expexp : NOT expexp : '(' exp ')'lhs : expand_setvarlhs : symbollhs : lhs '[' exp_list ']'lhs : lhs '.' noexpand_namelhs : lhs '^' '.' noexpand_namelhs : lhs ARROW noexpand_namelhs : '*' lhslhs : lhs '^'lhs : lhs '(' opt_exp_list ')'boolean_exp : expconstant : INTconstant : CHARconstant : REALconstant : STRINGconstant : WSTRINGsymbol : namesymbol : '.' nameline_number_symbol : INTline_number_symbol : DOLLARline_number_symbol : LINESYMexpand_setvar : SETVARnoexpand_name : namenoexpand_name : SETVARname : NAMEname : keywordkeyword : ALIASkeyword : ALLkeyword : ANDkeyword : ASSIGNkeyword : ATkeyword : BANDkeyword : CALLkeyword : CASEkeyword : CATCHkeyword : CLEARkeyword : CLEARIkeyword : CONTkeyword : DEBUGkeyword : DELETEkeyword : DETACHkeyword : DIVkeyword : DOWNkeyword : DUMPkeyword : EDITkeyword : EXPkeyword : FILEkeyword : FUNCkeyword : GOTOkeyword : GOTOIkeyword : HELPkeyword : IGNOREkeyword : INkeyword : LISTkeyword : LISTIkeyword : MODkeyword : MOVEkeyword : MULTPROCkeyword : NEXTkeyword : NEXTIkeyword : NILkeyword : ORkeyword : PRINTkeyword : PROMPTkeyword : PSYMkeyword : QUITkeyword : REGISTERSkeyword : RERUNkeyword : RETURNkeyword : RUNkeyword : SCREENkeyword : SETkeyword : SHkeyword : SIZEOFkeyword : SKIPkeyword : SOURCEkeyword : STATUSkeyword : STEPkeyword : STEPIkeyword : STOPkeyword : STOPIkeyword : TRACEkeyword : TRACEIkeyword : UNALIASkeyword : UNSETkeyword : UPkeyword : USEkeyword : WATCHkeyword : WHATISkeyword : WHENkeyword : WHEREkeyword : WHEREISkeyword : WHICHkeyword : WINSkeyword : WINIkeyword : XORadt.catrun & rerun may be used only on originating process. adt.catNested subarrays are illegal.adt.catIllegal use of subarrays.adt.catcan not assign to a subprogram@(#)asm.c 1.11 AIX.sassembler(noname)%s = %d(noname)&%s = 0x%x(noname)%s (0x%x):(noname)%s$string[%s]%.*s/source/src.i386/cmd/dbx/asm.c%ctruefalse0x%x0%o%de777 88888887787@@&@.@incl.catassertion failed at line %d in file %sadt.catbad real size %d@(#)events.c 1.10 AIX.s$line$proc$pccan't find $pc$retaddr@undsp %d @brk ? %d 0x%x d %d @brk %s %d 0x%x d %d /source/src.i386/cmd/dbx/events.c/source/src.i386/cmd/dbx/events.c(noname)(noname)trace { ; } [%d] in at i at when when [internal error: trace id %d not found] @undsp %d adding trinfo for "" @dsp %d = @cnt = @dsp %d = @cnt = = Xԣ@ܣ@@@Y8@@@Zh@p@@@[ʤ@Ҥ@E@@Q@@R.@6@ST@\@T@@U@¥@@@ @@&@.@V<@D@f@n@@@W@@adt.catdeleting breakpoint at 0x%x incl.catreference through nil pointer at line %d in file %sadt.cat!! dbx.translate: can't undo event %d? adt.catno executable code at line incl.catreference through nil pointer at line %d in file %sadt.catbad ancestry for "%s" & "%s"adt.catunnamed block adt.catnew bp at 0x%x for event ?? adt.catnew bp at 0x%x for event %d adt.cat!! dbx.bpfree: can't delete event %d adt.catbreakpoint for event %d found at location 0x%x adt.cat!! dbx.bpact: can't find event %d adt.catadding trace %d for event %d adt.catremoving trace %dadt.cat for event %dadt.catinitially (at line %d in "%s"): adt.catafter line %d in "%s": adt.catafter line %d: adt.cat!! dbx.fixbps: can't find event %d @(#)c.c 1.16 AIX.cc..cc++.icpp%*c(noname)const %s = %dsizeof(int) is 4sizeof(char) is 1sizeof(short) is 2sizeof(long) is 4sizeof(float) is 4sizeof(double) is 8sizeof(void) is 0typedef register : %d(noname)%s (noname)%s(noname)(noname)[%s](noname)%s)) ()(noname)%s()/source/src.i386/cmd/dbx/c.c/source/src.i386/cmd/dbx/c.c(noname)%s (noname)%s %s { /source/src.i386/cmd/dbx/c.c%*c}/source/src.i386/cmd/dbx/c.c[][%d](*(() (noname)@%s%s (noname)$$%s %s { (noname)%s, } (noname)(noname)%s %s (class %d)(noname)%s, [%s]"%.*s"/source/src.i386/cmd/dbx/c.c(nil)0x%x@%x(nil)(noname)%s()0x%x[%s]((noname)%s = , )structunionenum$unsafeboundsunion: ((noname)%s = , )aObHccddddctcc'dddcddcddddddddcdcvdc-gdi-gggZkZkZkZk}gZk-gCiZkZkhZkZk~hZkZkiZkZkZkZkZk}gZkiZkjZkZkirplllmAqAqAqAqWnmAqAqlloAqAqnAqAqPpAqAqAqAqAqlAqpAqlw8@@@b@j@~@@@@Pƭ@έ@@@"@,@`@h@@@@®@@@@ @.@6@N@X@@@@@`@¯@adt.catenumeration constant with value adt.catunknown range in Cadt.catunexpected missing type informationadt.catsource file "%s.c"adt.catexecutable file "%s"incl.catreference through nil pointer at line %d in file %sincl.catreference through nil pointer at line %d in file %sadt.catprinttype: symbol %s class %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catunresolved tag %sadt.catunexpected class %d for parameteradt.catprintval: bad class %dincl.catassertion failed at line %d in file %sadt.catbad real size %dadt.catprintval: bad class %dadt.catsubscript out of rangeuEvyyvyyywyyyFwyyyyvxx5xyyyyyyyyy y yxxxyyyyyyyyyyyyyyyyyyyyyyyyy@@GR@Z@Hn@v@@@@@̴@Դ@@@@@ (@0@ J@R@ v@~@ @@ @ĵ@ҵ@ڵ@@@@@@(#)check.c 1.13 AIX/source/src.i386/cmd/dbx/check.c$unsafeassign$unsafeassignincompatible sizesincompatible typesinvalid signal numberCannot find block(noname)"%s" is not a block"(noname)"%s" is not a procedure or function(noname)"%s" is empty"" not call-ableexpected variable to watch, found expected variable to watch, found (noname)"%s" is not a subprogram(noname)"%s" is not a subprogram"incl.catreference through nil pointer at line %d in file %sadt.catincompatible sizesadt.catincompatible typesadt.catinvalid signal numberadt.catexpected a symbol, found "adt.catsymbol not definedadt.catunexpected "at" or "in"adt.catcan't trace expressionsadt.catmissing variable to watchadt.catexpected variable to watch, found adt.catexpected variable, found adt.catexpected subprogram, found adt.catmissing lineadt.catexpected source line numberadt.catmissing addressadt.catexpected address, found " %l@x@@@@·@@(#)coredump.c 1.17 AIXr/source/src.i386/cmd/dbx/coredump.c/source/src.i386/cmd/dbx/coredump.c[data address 0x%x too low (lb = 0x%x)]data address 0x%x too high (ub = 0x%x)data address 0x%x too high (ub = 0x%x)system.catcan't open %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %s@(#)dbgload.c 1.14 AIXVname # of bytes : name :LinkName link number :Junk flag :Disassem flag :Mode flag :Timestamp :Junk : # of segs : Segment Name: Junk seg sz : Junk seg adr:(noname)(noname)"%s" not in Symbol tableAddr of entry :# of entries : D.A. load addr:#of data areas: Offset : /source/src.i386/cmd/dbx/dbgload.cadbgdump@@6@>@l@t@ @@ ʻ@һ@@@@@0@8@H@P@b@j@@@ @ļ@*%ڼ@@ @@adt.catVname buffer length (%d) error, some information may be lostadt.catVname length %d exceeds remaining bytes (%d)adt.catname length (%d) exceeds maximum (%d), maximum assumed for %sadt.catOptimize flag :adt.catcan not lookup timestamp symboladt.cat Segment Definition Tableadt.cat ENTRY POINT TABLE adt.catData area size:adt.cat DATA AREA TABLE adt.cat STACK FRAME FOR ONE PROCEDURE incl.catassertion failed at line %d in file %sadt.cat%s compiled with "d+"system.catcan't open file "dbgdump"adt.catencountered EOF while reading debug file size|@@@@@@ @@<@F@n@x@@@@@@@6@>@@(#)'src.i386/cmd/dbx/dbgslines.c, bos, 130, 0012' 1.2 AIX/source/src.i386/cmd/dbx/dbgslines.cPS entry loc :PS exit loc :PS exit size :/source/src.i386/cmd/dbx/dbgslines.cPS entries :PS reg info :PS reg mask :PS save loc :/source/src.i386/cmd/dbx/dbgslines.c/source/src.i386/cmd/dbx/dbgslines.c(noname)PS st location:SC info length:SC info format:/source/src.i386/cmd/dbx/dbgslines.c/source/src.i386/cmd/dbx/dbgslines.cSC line # :/source/src.i386/cmd/dbx/dbgslines.c/source/src.i386/cmd/dbx/dbgslines.cSC next sect :incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.cat CODE OFFSETS FOR ONE PROCEDURE incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.cat SOURCE LINE NUMBERS FOR ONE PROCEDURE "8OeHRv\zwܲQ^kxϵϵϵXLϵϵٻ@(#)dbgsyms.c 1.17 AIXSub version # :Static level :(noname)Rec field type:Offset :Bit size :Bit index :$$$$Enumerator val:Type number :Type kind :Enumerators :Subrange of :Subrange floor:Subr ceiling :Pointer to :/source/src.i386/cmd/dbx/dbgsyms.cSet of :Indexedby :Arrayof :Bits/element :String length :Fileof :Record size :String const :string constant typeFarray dim # :Farray arrayof:/source/src.i386/cmd/dbx/dbgsyms.cFarray flags :Farray lobound:Farray hibound:Farray elemsz :Equivalent typ:Function type :Union size :Indexedby :Spaceof :(noname) LOCAL VARIABLE Vtype : Addr mode :/source/src.i386/cmd/dbx/dbgsyms.c Offset : Offset :(noname)/source/src.i386/cmd/dbx/dbgsyms.c "%s" is declared, but it's data type is undefined. /source/src.i386/cmd/dbx/dbgsyms.c/source/src.i386/cmd/dbx/dbgsyms.c(noname)(noname)can't find data area "%s" Offset : Language byte :Info length :Count : (noname)/source/src.i386/cmd/dbx/dbgsyms.ccan't find parameter "%s" Next section :Info length :(noname)Reg var action:Reg var addr : can't find register variable "%s"Next section :$b%dBlock infolen :Block id :Start lineno :End lineno : Out of memory reallocating proctabNext section :Block id :(noname)setting curblock to %s (noname)setting curblock to %s +@@@@'@@(@@)@@*2@:@Z@d@@@@@@@ @@,@4@D@N@v@@@@@@ @@<@D@b@j@@@@@@@ @@ @@!>@F@"j@r@#@@$@@%@@&"@*@adt.catVersion number:adt.catFunction type :adt.cat USER DEFINED TYPE adt.catData is packedadt.catPacked keyword is presentadt.catinvalid size for pascal scalarincl.catassertion failed at line %d in file %sadt.catFortran char :incl.catassertion failed at line %d in file %sadt.catunsupported flag value for fortran array typeadt.catunknown type found: %dadt.catDefref flag :incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catunexpected indirect external data areaadt.catvariable in extended registeradt.catunknown addressing mode "0x%x"adt.catdo not support BASICadt.catunknown language typeadt.cat PROCEDURE adt.catno procedure %s for parameter processingincl.catassertion failed at line %d in file %sadt.cat PARAMETER LIST FOR ONE PROCEDURE adt.catno procedure %s for register variablesadt.catvariable "%s" spilled from registeradt.catvariable "%s" loaded into registeradt.cat REGISTER VARIABLES FOR ONE PROCEDURE adt.cat UNNAMED BLOCK INFO FOR ONE PROCEDURE @(#)dbgtypetab.c 1.15 AIXcharacter*(*)%dcharacter*/source/src.i386/cmd/dbx/dbgtypetab.c/source/src.i386/cmd/dbx/dbgtypetab.c/source/src.i386/cmd/dbx/dbgtypetab.c/source/src.i386/cmd/dbx/dbgtypetab.c(noname)can't find bound for fortran adjustable array/source/src.i386/cmd/dbx/dbgtypetab.c/source/src.i386/cmd/dbx/dbgtypetab.c(noname)(noname)(noname)(noname)bad tid %d in findtidtypetable dump %d: 0x%x %d: 0x%x %d: 0x%x %d ... %d: 0x%x %s: builtin type id %d out of rangevoidshortintunsigned shortunsigned intlongunsigned longcharfloatdoublesigned charstringintegershortrealrealcharalfaalphastringptrintegerrealcharintegerlongintrealdoublecharbooleantextrealimaginteger*1integer*2integerrealreal*8logical*1logical*2logicalcomplexcomplex*16p@z@@@@@@@8@B@j@t@,@@incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.cat%s: builtin string type id %d out of rangeqaPPaq@@2@@3@@4"@*@5H@P@-r@z@.@@/@@0@@1(@0@b@j@@(#)debug.c 1.6 AIX|@@@@@@@@@itofendxqline[op %d]nopnamesymlconcconfconsconrvalindexadt.catdebugging flags:adt.cat 1 trace scanner return valuesadt.cat 2 trace breakpointsadt.cat 3 trace executionadt.cat 4 trace tree buildingadt.cat 5 trace tree evaluationadt.cat -[12345] turns off corresponding flagadt.cat 6 dump function tableadt.cat 7 print ptrace informationadt.catcan't debug scanner (not compiled with LEXDEBUG)adt.catunknown debug flag[[}_!:.*C^xbH|8a<\_{Jh{x&'<XJ<~<v11##kh$OL&RU?BYo455X5556&4<4U4h4{444`4B@@@@@@@@@@@@@@@(#)eval.c 1.27 AIXtopeval() /source/src.i386/cmd/dbx/eval.c(noname)"%s" is not activereference through nil pointer%s ii(noname)/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c@pmt %s %s /source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.cunknown event %ldtracei: (noname)@trc %s %s %d 0x%x trace in %s::(noname)@trc %s %s %d 0x%x @dsp %d = @cnt : = eval: bad op %d(noname)/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c@brk ? 0 0x%x %c %d @brk %s %d 0x%x %c %d @brk ? 0 0x%x %c %d @brk %s %d 0x%x %c %d expression too large to trace (limit is %d bytes)/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.cmalloc/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c/source/src.i386/cmd/dbx/eval.c$frame$frame must be an address(noname)(noname)no source lines for "%s"$listwindow(noname)no source lines for "%s"second number must be greater than first , %s@reg $eax: 0x%08x $ebx: 0x%08x $ecx: 0x%08x $edx: 0x%08x $esp: 0x%08x $ebp: 0x%08x $esi: 0x%08x $edi: 0x%08x $eip: 0x%08x $eflags: 0x%08x Set status flags: $fctl: $fst: $ftag: $fip: $fop:  $fr%d: $fr%d: 0x%02x0x%8.8x0x%8.8x(noname)$unsafegotor/dev/hftonoffmixedlowerupperdefault@@:6@>@=N@V@Fj@r@P@@>C@@>C@@?C@@!(@$@4@<@^@f@@@@@@@@@.@6@N@V@n@v@@@@@@@&@.@\@f@@@@@@@@"@J@R@6t@|@#@@7@@8@@@@9 @(@@@H@l@v@@@@@;@@8@B@j@t@@@]@@<@@B@L@t@~@@@@@> @@?(@0@J@R@r@z@@@@A@@B@@@C@@@D$@,@@E@@H@@EZ@b@Gr@z@H@@I@@@@R@Z@@@@@@"@d@l@@@J@@@@R@Z@@@@@@@R@Z@K@@@@ @@LP@X@@@ D@@ @@M@@N@ @O>@F@VM86ResumeNested TaskOverflowDirection BackwardInterrupt EnableTraceSignZeroAux CarryParityCarryincl.catreference through nil pointer at line %d in file %sadt.catbegin eval %s adt.catcan't evaluate a %sadt.catSubarray printing is not supported. adt.catreference through nil pointersystem.caterror: division by 0system.caterror: div by 0system.caterror: mod by 0system.catcan't read "%s"adt.catSymbols are not folded (mixed). adt.catSymbols are folded to lower case. adt.catSymbols are folded to upper case. adt.catSymbols are folded based upon current language. adt.catCurrently symbols are adt.catnot folded (mixed). adt.catfolded to lower case. adt.catfolded to upper case. adt.catnot folded. incl.catreference through nil pointer at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catrun or rerun allowed only on initial processincl.catreference through nil pointer at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catunknown event %ldincl.catassertion failed at line %d in file %sadt.catscreen not supported under xdbx. adt.catMulti-process debugging is not supported adt.catDetach is not supported adt.catend eval %s adt.catexpression too large to evaluateadt.catstack underflowadt.catbad size %d in popsmalladt.cat[internal error: nil frame for %s]incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.cat[internal error: size %d in popsmall]adt.catexpression too large to trace (limit is %d bytes)incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %ssystem.catcan't allocate memory for constant string adt.catCan't assign to this variable until first statementincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catcan not list a moduleadt.catno source lines for "%s"adt.catline numbers must be positive adt.catsecond number must be greater than first adt.catAddresses must be positive adt.catNo assembly code for that source line numberadt.catNested Taskadt.catOverflowadt.catDirection Backwardadt.catInterrupt Enableadt.catunnamed block adt.cat%s is not a procedure or functionadt.catprogram is not executableadt.catGoto address is not within current function. (set $unsafegoto to override)adt.catrun - begin execution of the programadt.catprint - print the value of the expressionadt.catwhere - print currently active proceduresadt.catstop at - suspend execution at the lineadt.catstop in - suspend execution when is calledadt.catcont - continue executionadt.catstep - single step one lineadt.catnext - step to next line (skip over calls)adt.cattrace - trace execution of the lineadt.cattrace - trace calls to the procedureadt.cattrace - trace changes to the variableadt.cattrace at - print when is reachedadt.catstatus - print trace/stop's in effectadt.catregisters - display register setadt.catdelete - remove trace or stop of given numberadt.catcall - call a procedure in programadt.catwhatis - print the declaration of the nameadt.catlist , - list source linesadt.catquit - exit dbxsystem.cat%s: file already exists, use ">!"system.catcan't create %sadt.catstandard out dup failedadt.catUsage: multproc { on | off } adt.catUsage: getcase { default | mixed | lower | upper } q:<<<<<<<<<<<<<<<q:<<<<<<<<<<<<<<;;;<9<c<;<<<<<<;<<<;<<<<;88A@A9^AfA|AA:AAAA`@\AAd@"A*Ah@]BAJAp@`AhAt@aAAx@bAA|@^AA@_AA@`AA@4A<A@TA\A@czAA@dAAAAAA7AA@(#)examine.c 1.15 AIXtAvAzA|AAAAAAAAAAAAAAAAAAAAAAAAA AAA0AFAbAzAAAAAA A?@asm %s %5d 0x 0x ?@asm %s %5d 0x 0x /source/src.i386/cmd/dbx/examine.c%08x: @mem non-positive repetition countsS%08x: "" ""  @mem sS %08x (noname)(%s+0x%x)%s(%s)%s%x "%s" terminated normally "%s" terminated abnormally (exit code %d) (noname)(noname).?@stp ? %s %d 0x%x @stp %s %s %d 0x%x (noname)(noname).?@stp ? %s %d 0x%x @stp %s %s %d 0x%x %s (%s) (%s)maind %dD %ldo %oO %lox %04xX %08xb \%oc '%c'h %01xs%cf %.9fg %.17gC '%wc'S%wcreserved addressing faultpriviliged instruction faultreserved operand faultinteger overflow trapinteger divide by zero trapfloating overflow trapfloating/decimal divide by zero trapfloating underflow trapdecimal overflow trapsubscript out of range trapfloating overflow faultfloating divide by zero faultfloating undeflow faultadt.catnon-positive repetition countadt.catbad print format "%s"incl.catunexpected value %d at line %d in file %sadt.catfirst address larger than secondadt.catreserved addressing faultadt.catpriviliged instruction faultadt.catreserved operand faultadt.catinteger overflow trapadt.catinteger divide by zero trapadt.catfloating overflow trapadt.catfloating/decimal divide by zero trapadt.catfloating underflow trapadt.catdecimal overflow trapadt.catsubscript out of range trapadt.catfloating overflow faultadt.catfloating divide by zero faultadt.catfloating undeflow faultadt.cat[signal %d]adt.cat execution completed (exit code %d) adt.cat execution completed adt.catunsetbp: couldn't find address %dJ A A= A AK& A. AeH AP AAj Ar A? A A A A@ A Af A Ag A AB( A0 ACH AP ADj Ar A A A A A  A AF A A  A AG<ADApA|AIAA!(AA@(#)execute.c 1.22 AIX` Ad Ah An Ar Ax A| A A A A A A A A A A A A A A A A A A A A A A A A A A A A A A$ A* A0 A6 A< AB AH AN AT AZ A` Af Al Ar Ax A~ A A A A A A A A A A A A[ %s ] echo '' %s; echor@cnt can't continue execution@cnt can't continue executioncan't continue execution(noname)@cnt (noname)(noname).?@stp ? %s %d 0x%x @stp %s %s %d 0x%x (noname)(noname).?@stp ? %s %d 0x%x @stp %s %s %d 0x%x at 0x%xno process to write towdebugging child, pid=%d, process stopped, waiting input -X%d,%d,%d,%dxdbxxdbxCould not reattach to child process on forkdebugging child, pid=%d, process stopped, waiting input %s%srHUPINTQUITILLTRAPIOTEMTFPEKILLBUSSEGVSYSPIPEALRMTERMURGSTOPTSTPCONTCLDTTINTTOUIOXCPUXFSZsig26MSGWINCHPWRUSR1USR2PROFDANGERVTALRMMIGRATEsig36sig37sig38sig39sig40sig41sig42sig43sig44sig45sig46sig47sig48sig49sig50sig51sig52sig53sig54sig55sig56sig57sig58SAKGRANTRETRACTSOUNDsig63adt.catAttempt to resolve "wildcards" in run or rerun failed.system.cattoo many argumentsadt.catmultiple input redirectsadt.catmultiple output redirectadt.catcan't continue executionadt.catprogram terminated by signal %dadt.catprogram exitedadt.catprogram exited with code %dadt.cat%s is not activeadt.catno place to return toadt.cat!! stepping over 0x%x adt.cat!! stepped over to 0x%x adt.cat!! stepping from 0x%x to 0x%x adt.cat Entering debugger ... adt.catstopped adt.catin adt.catno process to write toadt.catapplication forked, child pid=%d, process stopped, awaiting input adt.catCould not reattach to child process on forksystem.catdbx error - xdbx exec failed adt.catsignal "%s" unknownsystem.catcan't read "%s"@(#)fortran.c 1.10 AIX.ffortran(noname)(noname)parameter %s = (dummy argument) (noname)%s %s (/source/src.i386/cmd/dbx/fortran.c(noname)%d:%d(noname)%s:%d%d:(noname)%s(noname)%s:(noname)%s%d:*(noname)%s:*,)(noname)%s %s %s function subroutine(noname) %s (noname)(noname)(noname)%s(noname)%s, ''(noname)integer*1%ld(noname)integer*2%ld(noname)integer%ld(noname)logical(noname)real*8(noname)complex(,)(noname)complex*16(, )''printval: bad class %d%cfalsetrue0x%lx0%lo%ldparameter is not an array/source/src.i386/cmd/dbx/fortran.csubscript (noname) is type %s /source/src.i386/cmd/dbx/fortran.c/source/src.i386/cmd/dbx/fortran.c/source/src.i386/cmd/dbx/fortran.c/source/src.i386/cmd/dbx/fortran.c (%d,%d) = [%d] = hEhhh'iLi gjVgjjjjjjjjijIg*n9oNvHpNvNvNvBrNvNvNvNvNvNvNvtlmlmvvvvmlvvlllvvvvvvavvvvvvvlvlk8A@AhArAOAAPAAQAAAAh$A,Ai\AdAjAATAAUAAVAA.A8Ar`AhAsAAAAAA AA`<ADA\AfAadt.catunknown type class in fortran.typenameincl.catassertion failed at line %d in file %sadt.catsource file "%s.f"adt.catexecutable file "%s"adt.catclass %s in fortran_printdecladt.catunexpected class %d for parameteradt.catunknown type with size = 8 in fortran_printvaladt.catunknown type, size = 16 in fortran_printvaladt.catunknown type, size > 16 in fortran_printvaladt.catdon't know how to print a %sadt.catunknown type in fortran printintadt.catdummy argumentincl.catassertion failed at line %d in file %sadt.cattoo many subscripts for adt.catnot enough subscripts for incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.catsubscript out of rangeincl.catassertion failed at line %d in file %sJRZbjrzmAAAA@(#)frame.c 1.18 AIX(noname)sig_cleanup/source/src.i386/cmd/dbx/frame.c$unsafecallcpascalshortrealcharbooleancharbooleanrealintegercharboolean[internal error: bad size %d in pushretval]fflush_iobadt.catsavereg out of range (%d)incl.catassertion failed at line %d in file %s@(#)keywords.c 1.8 AIXA"A&A*A2A6A>ADAJAPAVA^AdAjArAzA~AAAAAAAAAAAAAAAAAAAAAAAAAAAA$A,A0A8A<A@AHANAVA^AdAjApAvA|AAAAAAAAAAAAAAAAAAAAAAA A A Acontcdeletedhelpheditelistlnextnprintpquitqregistersxrunrstepsstopststatusjwheret$mapaddrs$listwindow(noname)alias %s "%s" (noname)%s %s %s ((noname)%s, )(noname)(noname)"%s" is a program symbol -- use assign$mapaddrs$expandunions$dual@mode d $machine$source$machine@mode i $dual$source$source@mode s $dual$machine$hexints$octints$octints$hexints$noflargs$flargs(noname)$mapaddrs$hexints$octints$machine$source$expandunionsset (noname)%s _ A Aa( A0 Aaliasallandassignatbitandcallcasecatchclearclearicontdebugdeletedetachdivdowndumpeditexpfilefuncgotogotoihelpifignoreinlistlistimodmovemultprocnextnextinilnotorprintpromptpsymquitregistersrerunreturnrunscreensetshsizeofskipsourcestatusstepstepistopstopitracetraceiunaliasunsetupusewatchwhatiswhenwherewhereiswhich@wins@winixor?setvar?$@INTCHARREALNAMESTRING2>&1->..adt.cat%s is not aliasedadt.cat%s is not set@(#)languages.c 1.4 AIX.?$builtin symbols(nil)/source/src.i386/cmd/dbx/languages.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/languages.cassertion failed at line %d in file %s/source/src.i386/cmd/dbx/languages.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/languages.creference through nil pointer at line %d in file %s$A$A%A %A%A&%A2%AB%AR%Al%Ar%A|%A%A%A%A%A%A%A&A&A"&A4&AF&AX&An&A&A&A&A&A&A&A'A'A$'A:'AN'Ap'A'A'A'A'A'A'A'A(A$(A8(AL(A`(At(A(A(A(A(A(A(A)A)A()A<)AR)Al)A)A)A ?J)A)AJ)A)An)A*A`"A$*A,*A@(#)library.c 1.12 AIXSHELLcsh-cUnknown signal: %s: %s: %d: %s: %s: %d: warninginternal errorcmp: nil pointermov: nil sourcemov: nil destination(%d byte)(%d bytes) %x%s%d%02x%#*x%d%4.4x%d%08x%x%c%c%c%x%x%x%c%x%x%c%c%c%x%x%x%c%x0x%d0x0000000%x0x000000%2xsegment # :%d%02xseg offset :%d%06xno signalhangupinterruptquitillegal instructiontrace trapIOT instructionEMT instructionfloating point exceptionkillbus errorsegmentation violationbad argument to system callbroken pipealarm clocksoft killurgent I/O conditionstop signal not from ttystop signal from ttycontinuechild terminationstop (tty input)stop (tty output)possible input/outputexceeded CPU time limitexceeded file size limitreserved signal 26HFT data pendingwindow size changespower failure imminentuser signal 1user signal 2profiling time alarmsystem crash imminentvirtual time alarmmigrate a process to another CPUreserved signal 36reserved signal 37reserved signal 38reserved signal 39reserved signal 40reserved signal 41reserved signal 42reserved signal 43reserved signal 44reserved signal 45reserved signal 46reserved signal 47reserved signal 48reserved signal 49reserved signal 50reserved signal 51reserved signal 52reserved signal 53reserved signal 54reserved signal 55reserved signal 56reserved signal 57reserved signal 58secure attention keyHFT monitor mode grantedHFT monitor mode retractedsoundreserved signal 63system.cat panic: unreasonable memory allocation system.cat panic: out of memory adt.catmigrate a process to another CPUadt.catfatal error@(#)lists.c 1.4 AIX/source/src.i386/cmd/dbx/lists.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/lists.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/lists.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/lists.creference through nil pointer at line %d in file %s/source/src.i386/cmd/dbx/lists.cassertion failed at line %d in file %sQQQQQQQQQQQQQQQQQQQ'QQQQQ3Q'QQQQQQBk1A1A %1A1Al1A1A2A2A$2A,2AmB2AJ2Add2Al2A2A2Ag2A2Ah2A2A=3A3Ai,3A43Aj`3Ah3A!(v3A3A!(3A3A$%3A3AWP3A3Asrc.i386/cmd/dbx/main.c()[Force option specified, using the "mdbx" command] [Force option specified, continuing with the "dbx" command] [Unknown force option specified, continuing with the "dbx" command] [MetaWare High C object module, using the "mdbx" command] [Unknown debug format, continuing with the "dbx" command] r.debug-qmdbx/usr/bin/mdbx[unable to execute /usr/bin/mdbx] dbx version 1.1 of AIX. Type 'help' for help. r.liblibc_s $machine$sourcerHOME%s/%sr/tmp/dbxXXXXrun %s < %s > %sreading symbolic information ... .-I-c-x-a-Xincomplete pipe information for -Xw-fvsc-fmcc-frrr/dev/mem/dev/memrcorecoredbgdumpdbgdump"-l" only applicable when compiled with LEXDEBUG"-y" only applicable when compiled with YYDEBUG%d%1s%d%1s%d%1s%dadt.catreading symbolic information ...system.catcan't open %sadt.catno source compiled with -gadt.cat[using memory image in %s] adt.cat%s does not match %sadt.catmissing directory for -Iadt.catmissing command file name for -cadt.cat -a option is not supported adt.catmissing pipe information for -Xadt.catincomplete pipe information for -Xsystem.catextraneous argument %sadt.catenter object file name (default is `%s'): adt.caton next line system.catcan't read %ssystem.catcan't read %ssystem.catcan't open /dev/memsystem.catunknown option '%c' 6A6AQF6AN6Anj6Ar6A6A6A 6A6A6A6A"7A,7AT7A^7A7A7A@(#)mappings.c 1.16 AIXsource file "%s" not compiled with -g/source/src.i386/cmd/dbx/mappings.c entering function %s, start address: 0x%x main/source/src.i386/cmd/dbx/mappings.c/source/src.i386/cmd/dbx/mappings.cw name: "%s" name: nil container: "%s" container: nil adt.cat entered /srcfilename/ with address = 0x%x adt.catno source file names exist adt.catsource file "%s" not compiled with -gincl.catassertion failed at line %d in file %sadt.cat is not in the function tableadt.catcreating new function table of size: %d incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sadt.cataddress: %d @(#)machine.c 1.17 AIX 111 1111!"#$11%&111111'()*+,-./0>A>A>A>A>A>A>A>A>A?A?A?A ?A?A?A?A?A ?A$?A(?A,?A0?A4?A8?A%d%%%s%%%s,%d-- getting operand type %d at 0x%x V s~y0vS))))))]+@@?A?A?A?A?A@A*@A2@AV@A^@A|@A@A@A@Ao@A@Ap@A@AqAAAAr.AA6AAsXAA`AAtAAAAuAAAAvAAAAwAAAAxBABAyDBALBAzbBAjBA{BABA|BABA}BABA~ CACA - g  > > > > > > > >  > > >  > > >     ,    c C R   c c  c -  c c  c c c c c c Q Q c c c c L ;LwtKA|KAKAKAKAKAqKALA2LAQAXQA`QAxQAQAQAQAa.outadt.catnesting depth too large (%d)adt.catentering block %s adt.catnesting depth underflow (%d)adt.catexiting block %s system.catcan't open %sadt.catbad magic number in %sadt.catoptional header missing in adt.cat!! reading from %s.d adt.catunexpected eof reading auxiliary entries missing %d)adt.catunexpected eof reading symbols (missing %d)adt.catchain not nil in deffuncadt.catadding sline (%d,0x%x) adt.catignored sline (%d,0x%x) adt.catline number %d and %d both map to address 0x%x @(#)operators.c 1.8 AIX^.,..++----**/ div mod not and or bitand | xor ~**sizeof < < <= <= > > >= >= = = <> <> <<>>alias := := callcasecatchfileclearclearicontdebugdelete alldeletedumpeditfuncgotohelpignorelistilistmoveprintpromptpsymregistersrunskipsourcestatusstepstopstopitracetraceiwatchwhatiswherewhereiswhichexaminewhenifonceprintcallprintifchangedprintrtnprintsrcposprocrtnstopifchangedstoptraceontraceofftype renamererunreturnupdowncallsearchsetunsetunalias@wins@winiscreenmultprocdetachQAQAQAQA"$QAQA$QARA"RARA$RARA RA$ RA$RA"RA$RA$$RA$*RA$4RA$8RA">RA@RADRA$LRAPRA$TRAZRA$`RAdRA$hRAnRA$tRAxRA$|RARA$RA$RARARARARARARARARARARARARARARARARARASASASASASA SA&SA.SA4SA>SABSAHSAPSAXSA^SAdSAjSApSAxSA~SASASASASASASASASASASASASASASASATATATA"TA*TA.TA4TA:TABTAFTALTATTAZTA`TAhTArTA@(#)src.i386/cmd/dbx/ops.caaaaadaamaasadcbadcladcwaddbaddladdwandbandlandwarplboundlboundwbsflbsfwbsrlbsrwbtclbtcwbtlbtrlbtrwbtslbtswbtwcallcbtwclccldclicltdcltscmccmpbcmplcmpwcwtdcwtldaadasdecbdecldecwdivbdivldivwenterf2xm1fabsfaddfaddlfaddpfaddsfbldfbstpfchsfcomfcomlfcompfcomplfcomppfcompsfcomsfcosfdecstpfdisifdivfdivlfdivpfdivrfdivrlfdivrpfdivrsfdivsfeniffreefiaddfiaddlficomficomlficompficomplfidivfidivlfidivrfidivrlfildfildlfildllfimulfimullfincstpfistfistlfistpfistplfistpllfisubfisublfisubrfisubrlfldfld1fldcwfldenvfldlfldl2efldl2tfldlg2fldln2fldpifldsfldtfldzfmulfmullfmulpfmulsfnclexfninitfnopfnsavefnstcwfnstenvfnstswfpatanfpremfprem1fptanfrndintfrstorfscalefsetpmfsinfsincosfsqrtfstfstlfstpfstplfstpsfstptfstsfsubfsublfsubpfsubrfsubrlfsubrpfsubrsfsubsftstfucomfucompfucomppfwaitfxamfxchfxtractfyl2xfyl2xp1hltidivbidivlidivwimulbimullimulwinbincbinclincwinlinsbinslinswintintoinwiretjbjbejcxzjecxzjljlejmpjnbjnbejnljnlejnojnsjnzjojpejpojsjzlahflarllarwlcallldslldswlealleaveleawleslleswlfsllfswlgdtlgsllgswlidtljmplldtlmswlocklooploopeloopnelslllslwlssllsswltrmovbmovlmovwmovsbwmovsblmovswlmovzwlmovzbwmovzblmulbmullmulwnegbneglnegwnopnotbnotlnotworborlorwoutboutloutwoutsboutsloutswseg_csseg_dsseg_esseg_fsseg_gsseg_sspopalpopawpopflpopfwpoplpopwpushalpushawpushflpushfwpushlpushwrclbrcllrclwrcrbrcrlrcrwreperepneretrolbrollrolwrorbrorlrorwsahfsalbsallsalwsarbsarlsarwsbbbsbblsbbwsetbsetbesetlsetlesetnbsetnbesetnlsetnlesetnosetnpsetnssetnzsetosetpsetssetzsgdtshldlshldwshrbshrdlshrdwshrlshrwsidtsldtsmswscmpbscmplscmpwslodbslodlslodwsmovbsmovlsmovwsscabsscalsscawsstobsstolsstowstcstdstistrsubbsublsubwtestbtestltestwverrverwxchgbxchglxchgwxlatxorbxorlxorw Y !"#$Y%&'()*+Y,-./012Y356789Y:;<=>?@YABYCDEFGHIYJKLMNOPQYYYYYYRSTUVWXY++ \\hh$$ -, ^]ji&% -, ^]ji&%!!%%AA(( #"'&ED*)!!%%AA(( #"'&ED*)  !!   %% AA ((   #"   '& ED *)__..a`0/++-,   GG[[bbcc>>FFHH       ++-,++-,++-,        ))\\^]\\^]\\^]**hhjihhjihhji$$&%$$&%$$&%     -, -, -, -, -, -,-,-,                         __a`ddfe  fe fe fe fe fefefe('!  $$OOQPIIKJ__a`UUWVLLNMRRTS          11gg    ##XX ZZYY""::66..22==99//33<<88;;7700441155  @? @?  CB CB  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~??@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*@+,-@@./@012@3@@456789@@?:;<=>@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@hXAlXApXAtXAxXA~XAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAXAYAYAYAYAYAYA YA&YA,YA0YA6YA]AB]AH]AN]AT]AZ]A`]Af]Al]Ar]Ax]A~]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A]A^A ^A^A^A"^A*^A2^A8^A>^AD^AJ^AP^AV^AZ^A`^Af^Al^Ap^At^Ax^A~^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A^A_A_A_A_A_A"_A(_A._A4_A:_A@_AF_AL_AP_AV_A\_Ab_Ah_An_At_Az_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A_A`A`A`A`A`A `A&`A,`A2`A8`A>`AD`AJ`AP`AV`A\`Ab`Ah`An`At`Az`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`A`AaAaAaAaA !"$%&'()*+-./01234ABCDE74xuA;@=LEKHrh{k:3jinmqopt~2C^}BP]RTegVXZ`bMDyzs54vu<>FEIHlN|O6\wQS?dfUGWJY_a8[9c #,:;HIJKNOPQRSTUVWXYZ[\]abcdfghijklmnostxyz{|}~56789<=>?@FGLM^_`epqruvw>c?@zAbCbCbCbCzAABhBA@AzAzAbCzAbCbCbCzAbCbC6BbCzAbC %sncheck -i %d /dev/hd%d >> %sr+%*[^ ] %*s%s%*[^ ] %*[^ ] %*d%scannot assign to register %d can't write 0A8ApAxAAAAAAAA&ADALAlAxA.AAAAAACAA2A:AXA`AAACAAAAAA0A8AHAPAnAvAAAAAAAO7AAP72A>A\AdAvA~A(AA7AAJ7AAadt.catCore file is outdated or doesn't match current programadt.catcould not attach to pid %d adt.catWaiting to attach to process %d ... adt.catAttaching to program from exec... adt.catcould not determine name of process %d adt.catDetermining program name... adt.catSuccessfully attached to %s... system.catcan't forksystem.catwarning: cannot execute %s adt.catno process active for programadt.cat!! pcont from 0x%x with signal %d (%d) system.caterror %d trying to continue processadt.cat!! ignored signal %d at 0x%x adt.cat!! pcont to 0x%x on signal %d adt.cat!! pstep from 0x%x with signal %d (%d) system.caterror %d trying to step processadt.cat!! pstep ignored signal %d at 0x%x adt.cat!! pstep to 0x%x on signal %d adt.catprogram exited adt.catprogram exited with code %d adt.catprocess : reg ERROR register out of range adt.catcannot assign to register %d adt.catprocess has terminatedadt.catfetch: bad seg %dsystem.catwrite to 0x%x errno %d (text busy?)system.catwrite to location 0x%x failedadt.catstore: bad seg %dadt.cat%d fetchs, %d reads, %d writes system.catcan't read system.catCan't write over running object file! system.catcan't write @(#)procinfo.c 1.9 AIX$eax$ecx$edx$ebx$esp$ebp$esi$edi$eip$eflags$fr%d$fctl$fst$ftag$fip$fop$ap$fp$sp$pcA&AZAbAxAAEAAAAAAAA*A2ADALAZAdAtAAWAA AAAAA$A4A>AfAnAX~AAAAAAA A"A*AJARA@(#)runtime.c 1.16 AIX/source/src.i386/cmd/dbx/runtime.c(noname)in "%s": $noargs, line %d in "%s" at 0x%x program is not activenot that many levelsprogram is not activeno current functionnot that many levels/source/src.i386/cmd/dbx/runtime.c_exit"/source/src.i386/cmd/dbx/runtime.c(noname)"%s" is not a procedure or function(noname)"pascal/source/src.i386/cmd/dbx/runtime.c(noname)/source/src.i386/cmd/dbx/runtime.c(noname)(noname)/source/src.i386/cmd/dbx/runtime.c(noname) for function "%s"(noname) for function "%s"(noname)incl.catreference through nil pointer at line %d in file %sadt.catprogram is not activeadt.catCould not determine current functionadt.catunnamed block adt.catno current functionadt.catnot that many levelsincl.catassertion failed at line %d in file %sadt.catcan't find _exitadt.catcan't call "incl.catassertion failed at line %d in file %sadt.cattoo many parametersadt.cattype mismatch for %sadt.catexpected variable, found "incl.catassertion failed at line %d in file %sadt.cat in call to %sincl.catassertion failed at line %d in file %sadt.cat in call to %sadt.catnot enough parameters to %sincl.catassertion failed at line %d in file %sadt.catUnable to process unknown language typeadt.catUnknown function typeadt.cat handled as a "C" integer type adt.cat returns successfully mA9mA@(#)scanner.c 1.15 AIX abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ_$@0123456789%s @end !*<>()[]alias expansion too large(noname)%s%*c > $hexin$hexin$octin/source/src.i386/cmd/dbx/scanner.cr char '\n'EOFchar '%c'"%s"6AA6AAAAAA2A:A^AfAAAdAAPAAOAAA A4AAdAnAAAAAAADALAfAnAAAAAAAAAFAPAxAAAAAAAA>AFA\AdAAAAAAA AAr@AHAs\AdAAAAAadt.cat%s loop at 0x%x (symhashtab[%d]) %dadt.cat symbols in %s adt.catdelete of non-symbol '%s'incl.catreference through nil pointer at line %d in file %sincl.catreference through nil pointer at line %d in file %sincl.catreference through nil pointer at line %d in file %sadt.cat[internal error: constval(non-CONST)]incl.catreference through nil pointer at line %d in file %sincl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catreference through nil pointer at line %d in file %sadt.cataddress: bad symbol "%s"adt.catreference to unknown typeadt.catcouldn't resolve referenceincl.catassertion failed at line %d in file %sadt.cat[internal error: unexpected array bound type]incl.catassertion failed at line %d in file %sincl.catassertion failed at line %d in file %sincl.catreference through nil pointer at line %d in file %sadt.catmissing size information for recordincl.catassertion failed at line %d in file %sadt.catexpected range for set base typeadt.catsize: bad class (%d)adt.catcan't compute size of a %s adt.catoperation not defined on "adt.catnon-numeric operand for division or exponentiationadt.catnon-integer operand for div or modadt.catSubarray on pointer to pointers not allowedadt.catToo many subscriptsadt.catnot enough subscripts for "adt.cat, expected boolean expressionincl.catreference through nil pointer at line %d in file %s!!!!!!!!a#!a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#a#"!!!a#a#!!a#a#a#!a#a#a#!a#a#a#a#!a#a#a#a#!a#'#a#a#a#a#a#a#a#a#a#;#"a#""!a#!a#!a#a#a# #!a#a#a#a#a#"a#a#a#a#a#a#a#!s(s(X( * * * * * * *X( * * *s( * * * *X( * * * *X( * * * * * * * * * * *)( *(('s)'(' * * *`)s( * * * * * * * * * * * * *s(\--._.u...(/.|//.0(/00000000000000000000000000000000000009/000-=AAAAPAXAxAA AAAAA"AVA^A@(#)tree.c 1.12 AIX/source/src.i386/cmd/dbx/tree.c"nextstepi%s (noname)%swatch trace %s%d { ; },/%d%s /source/src.i386/cmd/dbx/tree.c/source/src.i386/cmd/dbx/tree.cstopi if stopistop%s stopi watch traceitrace%s ;(noname)%s::0x%d'%c'%g"%s""%ws"[], ()^(noname).%s()%s%s[op %d]%ssystem.cattoo many arguments to type renameadt.catbuilt %s node 0x%x with arg[0] 0x%x arg[1] 0x%x adt.catcan't take address of registerincl.catreference through nil pointer at line %d in file %sadt.catexpected variable, found "incl.catreference through nil pointer at line %d in file %sincl.catreference through nil pointer at line %d in file %sadt.catbad op %d in prtree@(#)Version.c 1.3 AIXqmDC~3@?@(#)pow.c 1.15 AIXpow: DOMAIN error lib.cat@(#)matherr.c 1.4 AIXAAAAAAAA AWAA CCCC88;;CC;@(#)regcmp.c 1.16 AIXalpha:]upper:]lower:]digit:]xdigit:]alnum:]space:]punct:]print:]graph:]cntrl:]@(#)regex.c 1.20 AIXregex: stack overflow lib.catLBOOKLOOOOOOOWH2N`MILBOOK IOOOOOOOOOOOHOOOHHHHIIIIHOOONNNNLOOOHMLJNNNN/shlib/libc_s2ol ' k`&$N++쯄-67./usr/include/NLregexp.h85/* * AIX/370 * 5713-AFL * LICENSED MATERIALS - PROPERTY OF IBM * (c) Copyright 1989 IBM Corporation * (c) Copyright 1989 Locus Computing Corporation * All Rights Reserved */ #ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(@(#)NLregexp.h 1.35 AIX) /* Modified 11:42:34 4/3/91 */ #ifdef _MBCS #include #include #include #include #include #include /* * This macro converts an mbchar to an array of bytes. * it returns the address of the next position in p * Note that there are no embedded nulls in an mbchar_t * __len is incremented when a non-0 character was stored in * each of the upper bytes of p */ static int __len, __t; #define mbtombs(p,c) (__len=0,__t = (c), \ ((__t) & 0xff000000) || ((__t) <<=8), \ ((__t) & 0xff000000) || ((__t) <<=8), \ ((__t) & 0xff000000) || ((__t) <<=8), \ (p[3]=(__t) & 0x000000ff) && __len++, \ (p[2]=((__t) & 0x0000ff00)>>8) && __len++, \ (p[1]=((__t) & 0x00ff0000)>>16) && __len++, \ (p[0]=((__t) & 0xff000000)>>24) && __len++, \ p+__len) #ifdef __CAN_PASTE /* does compiler paste with ## ? */ #define __PASTE(a,b) a##b #else #define __PASTE(a,b) a/**/b #endif /* Used locally by NLregexp.h, makes conversion of one byte characters fast. -cl */ #define __mbstomb(mbch, mbs, len) \ ( (_mb_in_tbl->th_chlen_tbl[*((unsigned char *)mbs)] == 1) ? \ (*mbch = (mbchar_t)*mbs, 1) : \ mbstomb(mbch, mbs, len)) /* ** __PEEKC(mbs) sets the value mbs_peekc and mbs_len, and returns ** the mbchar_t at mbs ** evaluating mbs must not produce a side effect ** callers must examine mbs_peekc for ERR before using mbs_len (it may be -1) */ #define __PEEKC(mbs) ((-1==(__PASTE(mbs,_len)=__mbstomb(&__PASTE(mbs,_peekc),mbs,MB_LEN_MAX)))\ ? __PASTE(mbs,_peekc)=ERR\ : __PASTE(mbs,_peekc)) /* ** __GETC returns the next character at mbs, increments mbs. ** evaluating mbs must not have a side effect */ #define __GETC(mbs) (__PEEKC(mbs),mbs+=__PASTE(mbs,_len),__PASTE(mbs,_peekc)) /* ** __UNGETC retracts the mbs pointer by the width of ** the last character gotten by __GETC */ #define __UNGETC(mbs) (mbs -= __PASTE(mbs,_len), __PASTE(mbs,_len)=0) /* ** PUTC stuffs an mbchar_t into the char * mbs and bumps mbs */ #define __PUTC(str,mb) mbtombs(str,mb) /* ** must declare an _len and an _peekc for each cursor using __GETC, ** __PEEKC,__UNGETC */ #define __CURSOR(p) mbchar_t __PASTE(p,_peekc); short __PASTE(p,_len); char * p __CURSOR(ep); /* expression pointer */ __CURSOR(lp); /* line pointer */ __CURSOR(saveep); /* save expression pointer (for backreferencing) */ /* ** provide a local __ERROR handler that ends up invoking the user provided ** error handler, in case bozo (like sed) wants to do a return in ERROR */ #include jmp_buf __NLregexpErrbuf; #define __ERROR(errcode) _longjmp(__NLregexpErrbuf,errcode) /* ** The following __classtab table derives its masks from the following ctype.h ** excerpt. __classtab must be kept up to date with respect to ctype.h ** ** #define iswalpha(c) (_CTYPE[__wcindx(c)+1]&(_U|_L)) ** #define iswupper(c) (_CTYPE[__wcindx(c)+1]&_U) ** #define iswlower(c) (_CTYPE[__wcindx(c)+1]&_L) ** #define iswdigit(c) (_CTYPE[__wcindx(c)+1]&_N) ** #define iswxdigit(c) (_CTYPE[__wcindx(c)+1]&_X) ** #define iswalnum(c) (_CTYPE[__wcindx(c)+1]&(_U|_L|_N)) ** #define iswspace(c) (_CTYPE[__wcindx(c)+1]&_S) ** #define iswpunct(c) (_CTYPE[__wcindx(c)+1]&_P) ** #define iswprint(c) (_CTYPE[__wcindx(c)+1]&(_P|_U|_L|_N|_B)) ** #define iswgraph(c) (_CTYPE[__wcindx(c)+1]&(_P|_U|_L|_N)) ** #define iswcntrl(c) (_CTYPE[__wcindx(c)+1]&_C) */ struct /* this table is consulted */ { /* when we see [:...:] in a range */ char * name; /* the name of the character class */ short length; /* length of the name */ short ctype; /* the internal representation */ } __classtab[]={ {"alpha:]",7, _U|_L}, {"upper:]",7, _U}, {"lower:]",7, _L}, {"digit:]",7, _N}, {"xdigit:]",8, _X}, {"alnum:]",7, _U|_L|_N}, {"space:]",7, _S}, {"punct:]",7, _P}, {"print:]",7, _P|_U|_L|_N|_B}, {"graph:]",7, _P|_U|_L|_N}, {"cntrl:]",7, _C}, {NULL,NULL,NULL} }; #ifndef ERR #define ERR (-1) #endif #ifndef WORDSUPPORT1 #define WORDSUPPORT1 #endif #ifndef WORDSUPPORT2 #define WORDSUPPORT2 #endif #ifndef ADV_CASE #define ADV_CASE #endif /* #define RANGEMAX (NLCHARMAX/8+1) */ #define CBRA 2 #define CCHR 4 #define CDOT 8 #define CCL 12 #define CDOL 20 #define CCEOF 22 #define CKET 24 #define CBACK 36 #define NCCL 48 #define CEQV 80 #define CCOL 84 #define CCOLF 88 #define CHCL 92 #define MINUS 96 #define STAR 01 #define RNGE 03 #define NBRA 9 /* #define PLACE(c) ep[c >> 3] |= bittab[c & 07] #define ISTHERE(c, lp, c2) (c2 = _NCdec2(lp[0],lp[1],c),\ c = NCcoluniq(c),\ (ep[c >> 3] & bittab[c & 07]) != 0) */ #define PLACE(c) (__PUTC(ep,c)) #define ISTHERE(c,lp,c2) (cclass(ep,lp,c2)) char *braslist[NBRA]; char *braelist[NBRA]; char *loc1, *loc2, *locs; /* char bittab[] = { 1, 2, 4, 8, 16, 32, 64, 128 }; */ int sed, nbra; int ebra; int nodelim; int circf; int low; int size; /* ** Error codes lifted from the man page ** ** 11 Range endpoint too large. 16 Bad number. 25 "\"digit out of range. 36 Illegal or missing delimiter. 41 No remembered search string. 42 "\( \)" imbalance. 43 Too many "\(". 44 More than two numbers given in \{ \}. 45 "}" expected after "\". 46 First number exceeds second in \{ \}. 49 "[ ]" imbalance. 50 Regular expression overflow. */ #define BIG_RANGE 11 /* Range endpoint too large. */ #define BAD_NUM 16 /* Bad number. */ #define BAD_BACK 25 /* "\"digit out of range. */ #define BAD_DELIM 36 /* Illegal or missing delimiter. */ #define NO_SAVED 41 /* No remembered search string. */ #define BAD_LEFTP 42 /* "\( \)" imbalance. */ #define BAD_RIGHTP 43 /* Too many "\(". */ #define EX_COMMA 44 /* More than two numbers given in \{ \}. */ #define NO_CLOSE 45 /* "}" expected after "\". */ #define MAX_MIN 46 /* First number exceeds second in \{ \}. */ #define BAD_BRAK 49 /* "[ ]" imbalance. */ #define TOO_BIG 50 /* Regular expression overflow. */ #define STACK_EMPTY 51 /* backtrack stack empty */ #define STACK_FULL 52 /* backtrack stack full */ #define BAD_CHAR 60 /* wierd multibyte char */ #ifndef STACK_MAX #define STACK_MAX 512 /* intimately related to line length */ #endif char * _Stack [STACK_MAX]; int _Stack_pointer; /* pushes predecrement sp */ static int CLOCALE; /* see if the process is in the ascii locale */ #define ___pop() ((_Stack_pointer < STACK_MAX) ? _Stack[_Stack_pointer++] : (__ERROR(STACK_EMPTY),(char *)0)) char * __pop() { return ___pop(); } char * __push(lineptr) char * lineptr; { if (--_Stack_pointer < 0) __ERROR(STACK_FULL); return (_Stack[_Stack_pointer] = lineptr); } char * compile(instring, ep, endbuf, seof) register char *ep; char *instring, *endbuf; { register mbchar_t c; register eof = seof; char *lastep = instring; char *cclcnt; char bracket[NBRA], *bracketp; int i, cflg, closed; char class[16]; /* compare buffer for use in __classtab */ int classlen; /* length of word in class[] */ INIT /* Dependent declarations and initializations */ if (_CLOCALE) CLOCALE = 1; else CLOCALE = 0; if (i = _setjmp(__NLregexpErrbuf)) { ERROR(i); } lastep = 0; if ((c = GETC()) == eof || c == '\n') { if (c == '\n') { UNGETC(c); nodelim = 1; } if (*ep == 0 && !sed) __ERROR(NO_SAVED); RETURN(ep); } bracketp = bracket; circf = closed = nbra = ebra = 0; if (c == '^') circf++; else UNGETC(c); WORDSUPPORT1 while (1) { if (ep >= endbuf) __ERROR(TOO_BIG); c = GETC(); if (c != '*' && ((c != '\\') || (PEEKC() != '{'))) lastep = ep; if (c == eof) { WORDSUPPORT2 *ep++ = CCEOF; RETURN(ep); } switch(c) { case ERR: ERROR(BAD_CHAR); /*NOTREACHED*/ break; case '.': *ep++ = CDOT; continue; case '\n': if (!sed) { UNGETC(c); *ep++ = CCEOF; nodelim = 1; RETURN(ep); } else __ERROR(BAD_DELIM); case '*': if (lastep == 0 || *lastep == CBRA || *lastep == CKET) goto defchar; *lastep |= STAR; continue; case '$': if (PEEKC() != eof && PEEKC() != '\n') goto defchar; *ep++ = CDOL; continue; case '[': *ep++ = CCL; cclcnt = ep++; saveep = ep; if ((c = GETC()) == '^') { c = GETC(); ep[-2] = NCCL; } do { if ((c == '\0') || (c == ERR)) __ERROR(BAD_BRAK); else if (c=='[') /* ugh! XPG3 crud */ switch(c = GETC()){ case ERR: __ERROR(BAD_BRAK); /*NOTREACHED*/ case ':':/* ctype-ish character class */ for (classlen=0;classlen < sizeof(class);) { if (']' == (c = class[classlen++] = GETC())) break; if (!c) __ERROR(BAD_BRAK); if (seof == c) __ERROR(BAD_BRAK); } class[classlen] = '\0'; for (i=0; __classtab[i].name; i++) if (!strncmp(class,__classtab[i].name,__classtab[i].length)) { *ep++ = CHCL; *ep++ = __classtab[i].ctype>>8; *ep++ = __classtab[i].ctype&0xff; break; } if (!__classtab[i].name) __ERROR(BAD_BRAK); continue; case '=':/* equivalence class */ c = GETC(); if ((ERR == c) || ('\0' == c)) __ERROR(BAD_BRAK); *ep++ = CEQV; if (CLOCALE) *ep++ = c; else ep = __PUTC(ep, c); /* eat the rest of the expression */ if (GETC() != '=') __ERROR(BAD_BRAK); if (GETC() != ']') __ERROR(BAD_BRAK); continue; case '.':/* extended collation character */ *ep++ = CCOL; while ('.' != (c=GETC())) { if ((ERR==c) || ('\0'==c)) __ERROR(BAD_BRAK); if (CLOCALE) *ep++ = c; else ep = __PUTC(ep, c); } if (']' != GETC()) __ERROR(BAD_BRAK); *ep++ = CCOLF; /* follower */ continue; default: /* The [ was just a normal character */ /* We really need 2 characters of */ /* lookahead here, since we need to */ /* see the [ and the following char */ /* before we know if this is an XPRG3 */ /* special jobber. We get by with */ /* one character of pushback and the */ /* fact that the only character we */ /* could have seen before the pushed */ /* back one is a left bracket. */ UNGETC(c); c='['; /*FALLTHROUGH*/ } if ((c == '-') && (ep > cclcnt+1) && (PEEKC()!=']')) { register char * p; for (p = ep; p >= saveep; p--) p[1] = p[0]; *saveep = MINUS; ep++; /* we added one byte */ continue; } saveep = ep; /* need this to retract ep */ *ep++ = CCHR; if (CLOCALE) *ep++ = c; else ep = __PUTC(ep, c); } while ((c = GETC()) != ']'); if ((ep - cclcnt) > 255) __ERROR(TOO_BIG); else *cclcnt = ep - cclcnt; continue; case '\\': switch(c = GETC()) { case '(': if (nbra >= NBRA) __ERROR(BAD_RIGHTP); *bracketp++ = nbra; *ep++ = CBRA; *ep++ = nbra++; continue; case ')': if (bracketp <= bracket || ++ebra != nbra) __ERROR(BAD_LEFTP); *ep++ = CKET; *ep++ = *--bracketp; closed++; continue; case '{': if (lastep == (char *) 0) goto defchar; *lastep |= RNGE; cflg = 0; nlim: c = GETC(); i = 0; do { if('0' <= c && c <= '9') i = 10 * i + c - '0'; else __ERROR(BAD_NUM); } while (((c = GETC()) != '\\') && (c != ',')); if (i > 255) __ERROR(BIG_RANGE); *ep++ = i; if (c == ',') { if (cflg++) __ERROR(EX_COMMA); if ((c = GETC()) == '\\') *ep++ = 255; else { UNGETC(c); goto nlim; /* get 2'nd number */ } } if (GETC() != '}') __ERROR(NO_CLOSE); if (!cflg) /* one number */ *ep++ = i; else if ((ep[-1] & 0377) < (ep[-2] & 0377)) __ERROR(MAX_MIN); continue; case '\n': __ERROR(BAD_DELIM); case 'n': c = '\n'; goto defchar; default: if (c >= '1' && c <= '9') { if ((c -= '1') >= closed) __ERROR(BAD_BACK); *ep++ = CBACK; if (CLOCALE) *ep++ = c; else ep = __PUTC(ep,c); continue; } } /* Drop through to default to use \ to turn off special chars */ defchar: default: lastep = ep; *ep++ = CCHR; if (CLOCALE) *ep++ = c; else ep = __PUTC(ep, c); } } } int __advanceerrno; advance(lp, ep) register char *lp, *ep; { int err; __advanceerrno = 0; if (err = _setjmp(__NLregexpErrbuf)) { char errbuf[128]; __advanceerrno = err; return(0); } _Stack_pointer = STACK_MAX; return(__advance(lp,ep)); } int __steperrno; step(p1, p2) register char *p1, *p2; { register int c; mbchar_t p1_peekc, p2_peekc; short p1_len, p2_len; int err; __steperrno = 0; if (err = _setjmp(__NLregexpErrbuf)) { char errbuf[128]; __steperrno = err; return(0); } _Stack_pointer = STACK_MAX; if (circf) { loc1 = p1; return(__advance(p1, p2)); } /* fast check for first character */ if (CLOCALE) { if (*p2 == CCHR) { c = *(p2+1); do { if (c == *p1) { if (__advance(p1, p2)) { loc1 = p1; return(1); } } } while (*p1++); return(0); } /* regular algorithm */ do { if (__advance(p1, p2)) { loc1 = p1; return(1); } } while (*p1++); return(0); } else { if (__PEEKC(p2) == CCHR) { char *savep2 = p2; (void)__GETC(p2); c = __PEEKC(p2); p2 = savep2; do { if (c == __PEEKC(p1)) { if (__advance(p1, p2)) { loc1 = p1; return(1); } } } while(__GETC(p1)); return(0); } /* regular algorithm */ do { if (__advance(p1, p2)) { loc1 = p1; return(1); } } while (__GETC(p1)); return(0); } } __advance(lp, ep) register char *lp, *ep; { register char *curlp; register int c; char *bbeg; int ct, c2; while(1) { switch(*ep++) { case CCHR: if (CLOCALE) { if (*ep++ == *lp++) continue; } else { c = __GETC(ep); if (c == __GETC(lp)) continue; } return(0); case CDOT: if (CLOCALE) { if (*lp++ == 0) return(0); } else { if (!__GETC(lp)) return(0); } continue; case CDOL: if (*lp == 0) continue; return(0); case CCEOF: loc2 = lp; return(1); case NCCL: case CCL: if (!ISTHERE(c, lp, &c2)) return(0); lp += c2; ep += *ep; continue; case CBRA: braslist[*ep++] = lp; continue; case CKET: braelist[*ep++] = lp; continue; case CCHR | RNGE: if (CLOCALE) { c = *ep++; getrnge(ep); while (low--) { if (c != *lp++) return(0); } curlp = lp; while (size-- && c == *lp) { __push(lp); ++lp; } } else { c = __GETC(ep); getrnge(ep); while (low--) { if(__GETC(lp) != c) return(0); } curlp = lp; while (size-- && c == __PEEKC(lp)) { __push(lp); __GETC(lp); } } ep += 2; goto star; case CDOT | RNGE: getrnge(ep); if (CLOCALE) { while (low--) { if (*lp++ == 0) return(0); } curlp = lp; while (size-- && *lp) { __push(lp); ++lp; } } else { while (low--) { if (!__GETC(lp)) return(0); } curlp = lp; while (size-- && __PEEKC(lp)) { __push(lp); __GETC(lp); } } ep += 2; goto star; case NCCL | RNGE: case CCL | RNGE: getrnge(ep + *ep); while (low--) { if (!ISTHERE(c, lp, &c2)) return(0); lp += c2; } curlp = lp; while (size-- && ISTHERE(c, lp, &c2)) { __push(lp); lp += c2; } ep += *ep+2; goto star; case CBACK: bbeg = braslist[*ep]; ct = braelist[*ep++] - bbeg; if (ecmp(bbeg, lp, ct)) { lp += ct; continue; } return(0); case CBACK | STAR: bbeg = braslist[*ep]; ct = braelist[*ep++] - bbeg; curlp = lp; while (ecmp(bbeg, lp, ct)) lp += ct; while (lp >= curlp) { if (__advance(lp, ep)) return(1); lp -= ct; } return(0); case CDOT | STAR: curlp = lp; if (CLOCALE) { while (*lp) { __push(lp); ++lp; } } else { while (__PEEKC(lp)) { __push(lp); (void) __GETC(lp); } } goto star; case CCHR | STAR: curlp = lp; if (CLOCALE) { c = *ep++; while (c == *lp) { __push(lp); ++lp; } } else { c = __GETC(ep); while (c == __PEEKC(lp)) { __push(lp); (void) __GETC(lp); } } goto star; case NCCL | STAR: case CCL | STAR: curlp = lp; while (ISTHERE(c, lp, &c2)) { __push(lp); lp += c2; } ep += *ep; goto star; star: while ((lp != locs) || (*ep && *ep!=CCEOF)) { if (__advance(lp, ep)) return(1); if (lp <= curlp) return(0); lp = __pop(); } return(0); ADV_CASE } } } getrnge(str) register char *str; { low = *str++ & 0377; size = (*str == 255) ? 20000: (*str & 0377) - low; } ecmp(a, b, count) register char *a, *b; register count; { while (count--) if (*a++ != *b++) return(0); return(1); } /* NOTE: this code is a hacked/lifted from libPW/regex.c */ /* ** here are the things we can see between square brackets: ** CIRCFL - only as the first character, and negates the result of a match ** ** CCHR (a character) ** CCOL (a whole bunch of characters) CCOLF ** CEQV (a character) ** CHCL (msb of the ctype mask) (lsb of the ctype mask) ** MINUS (any of the above) (any of the above) ** ** an equivalence class ([=x=]) at either end of a range matches any of ** the characters in that class. For example "[[=A=]-C]" matches any of ** the A's in the current collating sequence with any combination of ** diacriticals, or anything in the collating sequence between those A's ** and the character C. This probably doesn't mean much for Kanji, ** cest la vie. ** ** The original code automatically matched a range with all the characters ** between the *equivalence classes* containing the characters at the ends ** of the range. This is forbidden by XPG3. Therefore, we only match ** equiv. classes if the user asks for them. ** */ static int cclass(set, stream, stream_wid) char *set; /* pointer to the [...] set */ char *stream; /* the stream of test characters */ int *stream_wid; /* returns the width of the test character */ { register int stream_col;/* collation weight of the character */ register char *end; /* last character of range */ int f; /* return value of "match" */ wchar_t tmp_wc; /* misc wide char */ int range_start=0; /* start of range for eqvmap's & ranges */ int range_end=0; /* end of range for eqvmap's & ranges */ int len; /* misc length */ int colval; /* misc. collation weight */ wchar_t *ignored; /* (ignored) pointer to 1-to-n text */ short mask; /* CHCL mask built from the compiled expr */ wchar_t stream_wc; /* wide char of the character */ char *stream_beg; /* beginning of the stream */ if (*stream == 0) return(0); stream_beg = stream; /* so we can count the width */ if (CLOCALE) stream_wc = stream_col = *stream++; else { if ((len = _mbtowc(&stream_wc, stream, MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); if ((stream_col = wc_collate(stream_wc)) < 0) { if ((stream_col = _mbxcol(stream_col,(unsigned char **)&stream,&ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet) */ } else stream += len; } f = (set[-1] & ~(STAR | RNGE)) == CCL; end = set + *set++ - 1; /* *set points to byte after range */ *stream_wid = stream - stream_beg; while (set < end) { /* match stream_col with anything in set */ switch (*set++) { case MINUS: { /* brackets for vi % */ /* get range start */ switch (*set++) { case CEQV: if (CLOCALE) range_start = *set++; else { if ((len = _mbtowc(&tmp_wc,set,MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); set += len; range_start = wc_coluniq(tmp_wc); while (wc_eqvmap(range_start) == 0) range_start--; } break; case CCOL: if (CLOCALE) range_start = *set++; else { if ((len = _mbtowc(&tmp_wc,set,MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); if ((colval = wc_collate(tmp_wc)) < 0) { if ((range_start = _mbxcol(colval, (unsigned char **)&set, &ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet) */ if (*set++ != CCOLF) __ERROR(BAD_CHAR); /* improper collation sym */ } else { /* the collation object was a single character */ range_start = colval; set += len; } } continue; case CCHR: if (CLOCALE) range_start = *set++; else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); if ((colval = wc_collate(tmp_wc)) < 0) { if ((range_start = _mbxcol(colval, (unsigned char **)&set, &ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet) */ } else { /* the collation object was a single character */ set += len; range_start = colval; } } break; default: __ERROR(BAD_CHAR); /* no ctypes in ranges */ /*NOTREACHED*/ break; } /* get range end */ switch (*set++) { case CEQV: if (CLOCALE) range_end = *set++; else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); set += len; range_end = wc_coluniq(tmp_wc); while (wc_eqvmap(range_end+1) == 0) range_end++; } break; case CCOL: if (CLOCALE) range_end = *set++; else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); if ((colval = wc_collate(tmp_wc)) < 0) { if ((range_end = _mbxcol(colval, (unsigned char **)&set, &ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet) */ if (*set++ != CCOLF) __ERROR(BAD_CHAR); /* improper collation sym */ } else { /* the collation object was a single character */ range_end = colval; set += len; } } continue; case CCHR: if (CLOCALE) range_end = *set++; else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) == -1) __ERROR(BAD_CHAR); if ((colval = wc_collate(tmp_wc)) < 0) { if ((range_end = _mbxcol(colval, (unsigned char **)&set, &ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet) */ } else { /* the collation object was a single character */ set += len; range_end = colval; } } break; default: __ERROR(BAD_CHAR); /* no ctypes in ranges */ /*NOTREACHED*/ break; } if (range_end - range_start < 0) return 0; /* [b-a] & [^b-a] both match nothing */ if (range_start <= stream_col && stream_col <= range_end) return f; break; } case CEQV: if (CLOCALE) range_start = range_end = *set++; else { if ((len = _mbtowc(&tmp_wc,set,MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); set += len; range_start = range_end = wc_coluniq(tmp_wc); } while (wc_eqvmap(range_end+1) == 0) range_end++; while (wc_eqvmap(range_start) == 0) range_start--; if (range_start <= stream_col && stream_col <= range_end) return f; break; case CCOL: if (CLOCALE) range_end = *set++; else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) < 0) __ERROR(BAD_CHAR); if ((colval = wc_collate(tmp_wc)) < 0) { if ((range_end = _mbxcol(colval, (unsigned char **)&set, &ignored)) < 0) __ERROR(BAD_CHAR); /* 1-to-n map, no can do (yet)*/ if (*set++ != CCOLF) __ERROR(BAD_CHAR); /* improper collation sym */ } else { /* the collation object was a single character */ range_end = colval; set += len; } } if (range_end == stream_col) return f; break; case CHCL: mask = (*set++ << 8); /* cc@/i370 screws up the eval order */ mask |= *set++; if (mask & _CTYPE[__wcindx(stream_wc)+1]) return f; break; case CCHR: if (CLOCALE) { range_end = *set; if (stream_col == range_end) return f; ++set; } else { if ((len = _mbtowc(&tmp_wc, set, MB_CUR_MAX)) == -1) __ERROR(BAD_CHAR); range_end = wc_collate(tmp_wc); if (stream_col == range_end) return f; set += len; } break; default: __ERROR(BAD_CHAR); /* bogus character in range */ /*NOTREACHED*/ break; } } return (!f); } #else /* _MBCS not defined ==> 1.2 header */ /* Bit tables for ranges have increased from 16 bytes to 96 bytes! */ /* Callers beware: the value (endbuf-ep) better be enlarged... */ #include #ifndef WORDSUPPORT1 #define WORDSUPPORT1 #endif #ifndef WORDSUPPORT2 #define WORDSUPPORT2 #endif #ifndef ADV_CASE #define ADV_CASE #endif #define RANGEMAX (NLCHARMAX/8+1) #define CBRA 2 #define CCHR 4 #define CDOT 8 #define CCL 12 #define CDOL 20 #define CCEOF 22 #define CKET 24 #define CBACK 36 #define STAR 01 #define RNGE 03 #define NBRA 9 #define PLACE(c) ep[c >> 3] |= bittab[c & 07] #define ISTHERE(c, lp, c2) (c2 = _NCdec2(lp[0],lp[1],c),\ c = NCcoluniq(c),\ (ep[c >> 3] & bittab[c & 07]) != 0) char *braslist[NBRA]; char *braelist[NBRA]; char *loc1, *loc2, *locs; char bittab[] = { 1, 2, 4, 8, 16, 32, 64, 128 }; int sed, nbra; int ebra; int nodelim; int circf; int low; int size; char * compile(instring, ep, endbuf, seof) register char *ep; char *instring, *endbuf; { INIT /* Dependent declarations and initializations */ register c; register eof = seof; char *lastep = instring; int cclcnt; char bracket[NBRA], *bracketp; int closed; char neg; int lc; int i, cflg; lastep = 0; if((c = GETC()) == eof || c == '\n') { if(c == '\n') { UNGETC(c); nodelim = 1; } if(*ep == 0 && !sed) ERROR(41); RETURN(ep); } bracketp = bracket; circf = closed = nbra = ebra = 0; if(c == '^') circf++; else UNGETC(c); WORDSUPPORT1 while(1) { if(ep >= endbuf) ERROR(50); c = GETC(); if(c != '*' && ((c != '\\') || (PEEKC() != '{'))) lastep = ep; if(c == eof) { WORDSUPPORT2 *ep++ = CCEOF; RETURN(ep); } switch(c) { case '.': *ep++ = CDOT; continue; case '\n': if(!sed) { UNGETC(c); *ep++ = CCEOF; nodelim = 1; RETURN(ep); } else ERROR(36); case '*': if(lastep == 0 || *lastep == CBRA || *lastep == CKET) goto defchar; *lastep |= STAR; continue; case '$': if(PEEKC() != eof && PEEKC() != '\n') goto defchar; *ep++ = CDOL; continue; case '[': if(&ep[RANGEMAX+1] >= endbuf) ERROR(50); *ep++ = CCL; lc = 0; for(i = 0; i < RANGEMAX; i++) ep[i] = 0; neg = 0; if((c = GETC()) == '^') { neg = 1; c = GETC(); } do { if(c == '\0' || c == '\n') ERROR(49); if(c == '-' && lc != 0) { if((c = GETC()) == ']') { PLACE(NCcoluniq('-')); break; } i=GETC(); if (_NCdec2(c,i,c)==1) UNGETC(i); c = NCcoluniq(c); while(NCeqvmap(lc)==0) lc--; while(NCeqvmap(c+1)==0) c++; while(lc < c) { PLACE(lc); lc++; } } else { i=GETC(); if (_NCdec2(c,i,c)==1) UNGETC(i); c = NCcoluniq(c); } lc = c; PLACE(c); } while((c = GETC()) != ']'); if(neg) { for(cclcnt = 0; cclcnt < RANGEMAX; cclcnt++) ep[cclcnt] ^= -1; ep[0] &= 0374; } ep += RANGEMAX; continue; case '\\': switch(c = GETC()) { case '(': if(nbra >= NBRA) ERROR(43); *bracketp++ = nbra; *ep++ = CBRA; *ep++ = nbra++; continue; case ')': if(bracketp <= bracket || ++ebra != nbra) ERROR(42); *ep++ = CKET; *ep++ = *--bracketp; closed++; continue; case '{': if(lastep == (char *) 0) goto defchar; *lastep |= RNGE; cflg = 0; nlim: c = GETC(); i = 0; do { if('0' <= c && c <= '9') i = 10 * i + c - '0'; else ERROR(16); } while(((c = GETC()) != '\\') && (c != ',')); if(i > 255) ERROR(11); *ep++ = i; if(c == ',') { if(cflg++) ERROR(44); if((c = GETC()) == '\\') *ep++ = 255; else { UNGETC(c); goto nlim; /* get 2'nd number */ } } if(GETC() != '}') ERROR(45); if(!cflg) /* one number */ *ep++ = i; else if((ep[-1] & 0377) < (ep[-2] & 0377)) ERROR(46); continue; case '\n': ERROR(36); case 'n': c = '\n'; goto defchar; default: if(c >= '1' && c <= '9') { if((c -= '1') >= closed) ERROR(25); *ep++ = CBACK; *ep++ = c; continue; } } /* Drop through to default to use \ to turn off special chars */ defchar: default: lastep = ep; *ep++ = CCHR; *ep++ = c; if (NCisshift(c)) { c = GETC(); if(c == eof || ep >= endbuf) ERROR(50); *ep++ = c; } } } } step(p1, p2) register char *p1, *p2; { register c; if(circf) { loc1 = p1; return(advance(p1, p2)); } /* fast check for first character */ if(*p2 == CCHR) { c = p2[1]; do { if (*p1==c) if(advance(p1, p2)) { loc1 = p1; return(1); } if (NCisshift(*p1)) p1++; } while(*p1++); return(0); } /* regular algorithm */ do { if(advance(p1, p2)) { loc1 = p1; return(1); } if (NCisshift(*p1)) p1++; } while(*p1++); return(0); } advance(lp, ep) register char *lp, *ep; { register char *curlp; register int c; int c2; char *bbeg; int ct; while(1) { switch(*ep++) { case CCHR: c = *ep++; if(c == *lp++) if (!NCisshift(c) || *ep++ == *lp++) continue; return(0); case CDOT: if (*lp==0) return(0); else if( NCisshift(*lp++) ) lp++; continue; case CDOL: if(*lp == 0) continue; return(0); case CCEOF: loc2 = lp; return(1); case CCL: if (!ISTHERE(c, lp, c2)) return (0); lp += c2; ep += RANGEMAX; continue; case CBRA: braslist[*ep++] = lp; continue; case CKET: braelist[*ep++] = lp; continue; case CCHR | RNGE: c = *ep++; if (NCisshift(c)) { c2 = *ep++; getrnge(ep); while(low--) { if(*lp++ != c || *lp++ != c2) return(0); } curlp = lp; while (size-- && *lp == c && lp[1] == c2) lp += 2; } else { getrnge(ep); while(low--) { if(*lp++ != c) return(0); } curlp = lp; while (size-- && *lp == c) lp++; } ep += 2; goto star; case CDOT | RNGE: getrnge(ep); while(low--) { if (NCisshift(*lp)) lp++; if(*lp++ == '\0') return(0); } curlp = lp; while(size-- && *lp != '\0') { lp += (NCisshift(*lp) ? 2 : 1); } ep += 2; goto star; case CCL | RNGE: getrnge(ep + RANGEMAX); while(low--) { if (!ISTHERE(c, lp, c2)) return (0); lp += c2; } curlp = lp; while(size-- && ISTHERE(c, lp, c2)) lp += c2; ep += RANGEMAX+2; goto star; case CBACK: bbeg = braslist[*ep]; ct = braelist[*ep++] - bbeg; if(ecmp(bbeg, lp, ct)) { lp += ct; continue; } return(0); case CBACK | STAR: bbeg = braslist[*ep]; ct = braelist[*ep++] - bbeg; curlp = lp; while(ecmp(bbeg, lp, ct)) lp += ct; while(lp >= curlp) { if(advance(lp, ep)) return(1); lp -= ct; } return(0); case CDOT | STAR: curlp = lp; while(*lp) lp++; goto star; case CCHR | STAR: curlp = lp; c = *ep++; if (NCisshift(c)){ c2 = *ep++; while(*lp == c && lp[1] == c2) lp += 2; }else { while (*lp == c) lp++; } goto star; case CCL | STAR: curlp = lp; while (ISTHERE(c, lp, c2)) lp += c2; ep += RANGEMAX; goto star; star: while (lp != locs) { if (advance(lp, ep)) return (1); if (lp <= curlp) return (0); lp--; if (lp > curlp && NCisshift(lp[-1])) lp--; } return (0); ADV_CASE } } } getrnge(str) register char *str; { low = *str++ & 0377; size = (*str == 255)? 20000: (*str &0377) - low; } ecmp(a, b, count) register char *a, *b; register count; { while(count--) if(*a++ != *b++) return(0); return(1); } #endif /* _MBCS */ k($@++쯄-C./usr/include/sys/dktrace.h#ifndef H_SCCSID #endif /* !H_SCCSID */ H_SCCSID(@(#)dktrace.h 1.4 AIX) /* Modified: 18:08:58 9/22/89 */ /* * Copyright (C) 1989, Locus Computing Corporation * All Rights Reserved */ /* * (C) Copyright IBM Corp. 1989 * All Rights Reserved * Licensed Materials - Property of IBM */ /* RTMAP Trace Point Defines */ #define DK_INTR_LVL 0x01 /* Interrupt Level */ #define DK_KERNEL_SVC 0x02 /* Kernel SVC Call */ #define DK_RETURN_LVL 0x03 /* Return from Interrupt Level */ #define DK_PROG_CHECK 0x04 /* Program Check */ #define DK_PFAULT_ADD 0x05 /* Page Fault - Address */ #define DK_PFAULT_SEG 0x07 /* Page Fault - Segment */ #define DK_DISK_SLIH 0x08 /* Disk SLIH Entry */ #define DK_ASYNC_SLIH 0x09 /* ASYNC SLIH Entry */ #define DK_END_SVC 0x0E /* End Execution Control */ #define DK_KDD_STROKE 0x25 /* KDD Interrupt Level data scan code */ #define DK_DISK_START 0x26 /* DISK Start I/O */ #define DK_DISK_LEN 0x2A /* Disk Command Length */ #define DK_DISK_CMD 0x27 /* Disk Command */ #define DK_DISK_COMPL 0x2E /* Disk Transfer Complete */ #define DK_MINI_BLK 0x30 /* Minidisk Block Number */ #define DK_RDWT_CNT 0x33 /* Readi/Writei - byte count */ #define DK_EXEC 0x34 /* AIX Exec - success/failure */ #define DK_DISPATCH 0x36 /* AIX Dispatch - PID */ #define DK_FORK_PROC 0x38 /* AIX Fork - process group */ #define DK_FORK_PID 0x37 /* AIX Fork - process id */ #define DK_ASSG_GID 0x3A /* Assign Process Group id */ #define DK_RDWT_INODE 0x3C /* Readi/Writei - Inode ID */ #define DK_RDWT_MAJOR 0x3B /* Readi/Writei - Major/minor/flags */ #define DK_RDWT_SEQ1 0x3D /* Readi/Writei - path name */ #define DK_RDWT_SEQ2 0x7D /* Readi/Writei - path name */ #define DK_RDWT_SEQ3 0x3E /* Readi/Writei - path name */ #define DK_RDWT_SEQ4 0x3F /* Readi/Writei - Inode ID */ #define DK_VMM_CSEG 0x4E /* VMM - create segment */ #define DK_VMM_APAGE1 0x50 /* VMM - assign page lo add */ #define DK_VMM_APAGE2 0x51 /* VMM - assign page hi add */ #define DK_VMM_DSEG 0x53 /* VMM - destroy segment */ #define DK_FP_SEG 0x54 /* Floating Point seg. overrun */ #define DK_FP_EXECP 0x55 /* Floating Point 387 execption */ #define DK_USER_1 0x5A /* User hook 1 */ #define DK_USER_2 0x5B /* User hook 2 */ /* HFT Kernel User Defined Trace Points */ #define DK_CONSWRITE 1000 /* hftcons.c - conswrite */ #define DK_SCREEN 1100 /* hftansi.c - screen */ #define DK_PS_UPDATE 1200 /* hftansi.c - ps_update */ #define DK_VTMOUT 1300 /* vtmout.c - vtmout */ #define DK_VTMUPD2 1400 /* vtmupd2 - vtmupd2 */ #define DK_VDDSELECT 1500 /* hftansi.c - VDD select call */ #define DK_VTTREP 1600 /* hftansi.c - vttrep */ #define DK_VTTSCR 1700 /* hftansi.c - vttscr */ #define DK_HFTIC_BEL 1807 /* hftansi.c - bell single byte*/ #define DK_HFTIC_HT 1809 /* hftansi.c - ht single byte*/ #define DK_HFTIC_LF 1810 /* hftansi.c - lf single byte*/ #define DK_HFTIC_VT 1811 /* hftansi.c - vt single byte*/ #define DK_HFTIC_CR 1813 /* hftansi.c - cr single byte*/ /* Merge Kernel User Defined Trace Points */ #define DK_MR8250 3000 /* merge - vir8250 */ #define DK_MRKBD_OUT 3100 /* merge - virkbd OUT */ #define DK_MRKBD_IN 3110 /* merge - virkbd IN */ #define DK_MRDMA 3200 /* merge - virdma */ #define DK_MR8259 3300 /* merge - vir8259 */ #define DK_PORTA 3400 /* merge - PORTA */ #define DK_PORTB 3410 /* merge - PORTB */ #define DK_PORTC 3420 /* merge - PORTC */ #define DK_KBCMD 3430 /* merge - KBD CMD */ #define DK_KBDATA 3440 /* merge - KBD DATA */ /* DEKKO Card Hardware Defines */ #define DEKKO_4_HOOK 0x0110 #define DEKKO_2_HOOK 0x0114 #define DEKKO_START 0x0116 /* Macro to build trace data for dekko card */ /* id = trace id (8 bits) */ /* data = trace data ( 32 bit int, 16 bits used ) */ #if (PERFTRC) && (i386) #define TRACE( id, data) { \ int trc1, trc2; \ union dk_fix { \ int *fix1; \ int fix2; \ } dk_fixed; \ dk_fixed.fix1 = ( int * ) data; \ trc1 = ((dk_fixed.fix2 >> 8) & 0x0f) | (( dk_fixed.fix2 & 0xff) << 8); \ trc2 = ((id >> 4) & 0x0f) | (id << 12) | ((dk_fixed.fix2 >> 4) & 0x0f00); \ outw( DEKKO_4_HOOK, trc1); \ outw( DEKKO_4_HOOK+2, trc2); \ } #else #define TRACE(id, data) ; #endif /* Macro to build short trace data for dekko card */ /* id = trace id (8 bits) */ /* data = trace data ( 32 bit int, 4 bits used ) */ #if (PERFTRC) && (i386) #define SHORT_TRACE( id, data) { \ int trc1; \ union dk_fix { \ int *fix1; \ int fix2; \ } dk_fixed; \ dk_fixed.fix1 = ( int * ) data; \ trc1 = ((id >> 4) & 0x0f) | (id << 12) | ((dk_fixed.fix2 << 8) & 0x0f00); \ outw( DEKKO_2_HOOK, trc1); \ } #else #define SHORT_TRACE(id, data) ; #endif / #defi k6*$bO++-b ./usr/include/sys/hft/physdisp.h#ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(@(#)'kernel/ibm.h/physdisp.h, bos, 130, 0012' 1.5 AIX) /* Modified: 12:49:41 3/15/93 */ /* * (C) Copyright IBM Corp. 1989 * All Rights Reserved * Licensed Materials - Property of IBM */ #ifndef MAX_MON_ADDRS #define MAX_MON_ADDRS 10 #endif #ifndef MAX_MON_IO_PORTS #define MAX_MON_IO_PORTS 50 #endif #ifdef _MBCS #define NUM_DISPLAYS (59) #else #define NUM_DISPLAYS (49) #endif /* _MBCS */ /* Added 15 new device ID's */ /* Corresponding changes in physdisp.c must be made here */ /* * Physical device ID returned by HFQUERY ioctl. */ #define VGA7544 0x0413 /* they're the same, that's the way */ #define BRECON7544 0x0413 /* it was */ #define VGA7554 0x0415 /* same here */ #define BRECON7554 0x0415 #define VGA8503 0x0411 #define BRECON8503 0x0418 #define VGA8515 0x0410 #define VGA8512 0x0412 #define VGA8513 0x0413 #define VGA8514 0x0414 #define BRECON8503 0x0418 #define BRECON8512 0x0419 #define BRECON8513 0x041a #define BRECON8514 0x041b #define BRECON8507 0x041c #define BRECON8604 0x041d #define VGA8604 0x0416 #define VGA8507 0x0415 #define PLASMA 0x0421 #define BRECON8515 0x0417 #define IBM5574_M06 0x0415 #define IBM5574_W06 0x0415 #define IBM5574_C06 0x0412 #define IBM5574_C07 0x0414 #define IBM5574_C09 0x0414 #define XGA8507 0x0422 #define XGA8514 0x0423 #define XGA8515 0x0424 #define XGA8604 0x0425 #define VGA8518 0x0428 #define BRECON8518 0x0429 #define VGA8504 0x0430 #define BRECON8504 0x0443 #define VGA8517 0x0444 #define BRECON8517 0x0445 #define XGA8517 0x0446 #define VGA8516 0x0447 #define BRECON8516 0x0436 #define XGA8516 0x0437 #define XGA8503 0x0438 #define XGA8504 0x0439 #define XGA8512 0x0440 #define XGA8513 0x0441 #define XGA8518 0x0442 #define VGA8511 0x0428 #define BRECON8511 0x0429 #define XGA8511 0x0442 #define XGATWO9517 0x0450 #define XGATWO8517 0x0451 #define XGATWO9515 0x0452 /**********************************************************************/ /* */ /* Device Characteristics */ /* */ /**********************************************************************/ struct dev_char_struc { u_int rdev_id; /* device id used to identify this device */ u_char devname[20]; /* name of the device, null terminated */ u_short vdd_iocn; /* IOCN of the dev module (garbage??) */ int monitor; /* the unique id of the monitor */ u_short font_class; /* the class of font used with this device*/ /* i.e. bit patterns or command strings */ /* some devices are driven by draw cmds */ /* #######################################*/ /* the following 2 entries determine the */ /* # of rows/cols for a device that uses */ /* fixed hardware character generators */ /* (Like the VGA in mode 3) they specify */ /* the number of rows/cols in this fixed */ /* mode of operation */ int font_width; /* width in characters (i.e.80) */ int font_height; /* height in character lines (i.e.25) */ /* #######################################*/ u_short avt_format; /* the format of External Raster Arrays */ int bits_per_pel; /* total number of bits in each pel value */ /* i.e. 1, 2 , 4 */ u_char monitor_type; /* set if we have a color monitor */ u_char vlt_modify; /* set if the adapter VLT is modifiable */ /* i.e. change color pallete is available */ u_char adapter_status; /* set if the adapter is working properly */ u_char alpha; /* set if a hardware character gen is */ /* available for this device */ u_char apa; /* set if it can use the software fonts */ u_char blink; /* set = blink supported */ u_short width_pel; /* width of the screen in pels */ u_short height_pel; /* height of the screen in pels */ u_short width_mm; /* width of the screen in millimeters */ u_short height_mm; /* height of the screen in millimeters */ u_int color_total; /* # of colors that can be displayed */ u_short color_active; /* # of colors displayed simultaneously */ u_short color_fg; /* # of fg colors displayed simultaneously*/ u_short color_bg; /* # of bg colors displayed simultaneously*/ struct dev_color_table { u_int value[16]; /* colors displayed by the adapter */ } color_table; /* ###################################### */ short num_io_ports; /* # of i/o ports to that this adapter */ /* and display configuration will need */ /* Up to 20 non-contigous port ranges */ /* are supported */ /* ###################################### */ /* Following entries describe the RANGE */ /* of I/O ports used by this device */ /* These values are used by monitor mode */ /* application enable routines to give the*/ /* user access to the hardware I/O ports */ struct range_io_ports /* structure that defines i/o port ranges */ { u_int low_io_port; /* the lowest i/o port used by this device*/ u_int high_io_port; /* the highest i/o port used by this dev */ }io_ports[MAX_MON_IO_PORTS]; /* ###################################### */ short num_mem_segments;/* # of memory segments to follow, */ /* physical memory used by the adapter */ /* up to 10 non-contigous segments */ /* of memory are supported, null memory */ struct phys_mem_segments/* address or length terminates the list) */ { u_long base_memory; /* the physical address of the adapter */ int base_length; /* # bytes in the adapter refresh buffer */ }phys_mem[MAX_MON_ADDRS];/* array of memory segments */ }; 8511 kxl,$ O++-: ./usr/include/sys/i386/com232.h/* * LICENSED MATERIALS - PROPERTY OF IBM * (c) Copyright 1988-89, 1992 IBM Corp. * (c) Copyright 1988-89 Locus Computing Corporation * All Rights Reserved */ #ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(kernel/i386.h/com232.h, bos, 130, 0012 AIX) /* Modified: 10:14:43 11/3/92 */ /* * com232.h define data structures used in the interface between * the AIX rictty device driver and the com232 task on the * cyclone card. */ /* * Primary status bit definitions */ #define INBUSY 0x04 #define OUTBUSY 0x40 #define TASKBUSY 0x80 /* Task command codes from SU */ #define WAKEUP_CMD 0x01 /* Look at data structures for work */ /* * rtsdtr argument defines * int rtsdtr(unsigned char port, unsigned char select, unsigned char request) */ #define SEL_DTR 0x2 /* if set, write DTR request bit */ #define SEL_RTS 0x1 /* if set, write RTS request bit */ #define REQ_DTR 0x2 /* DTR request bit; on or off */ #define REQ_RTS 0x1 /* RTS request bit; on or off */ /* * linestatus defines */ #define LSTAT_NOPORT 0 /* could not allocate port */ #define LSTAT_REC 1 /* read date available */ #define LSTAT_XMIT 2 /* transmit done */ #define LSTAT_EXT 3 /* external status changed */ #define LSTAT_CMD 4 /* adapter command complete */ #define TOTAL_LSTATS 5 /* total number of line status flags */ /* * statinfo defines */ #define STAT_XOFF 0x01 /* hold transmission */ #define SEND_BRK 0x02 /* send break while on */ #define NO_MODEM 0x04 /* ignore external status, set DCD on*/ #define CTS_FLOW 0x08 /* use CTS as FLOW control */ #define SI_DTR 0x10 /* turn on DTR */ #define SI_RTS 0x40 /* turn on RTS */ /* * extstat defines */ #define RI 0x1 /* ring ind */ #define DCD 0x8 /* data carr det. */ #define DSR 0x10 /* date set ready */ #define CTS 0x20 /* clear to send */ #define BREAKDET 0x80 /* break cond */ /* * These command defines are provided for cases when the AIX device driver * needs to deliver a command to the ARTIC task. The interface is generalized * and allows for the definition of other command types. See rtycint() in * com232.c */ #define CMD_DONE 0 /* adapter command now complete */ #define CMD_UPD_EXTSTAT 1 /* set extstat to current values */ /* * input character error flags */ #define PARFLG 0x100 /* charater had a parity error */ #define BRKFLG 0x200 /* charater was a break */ #define NPORTS 8 /* number of ports supported by this driver */ #define SETCFLAG 0x8000 /* flag to indicate a new cflag value */ struct ricinbuf { short head; short tail; unsigned short msg[CBSIZE]; }; struct ricoutbuf { unsigned short count; unsigned char msg[CBSIZE]; unsigned char immdata; /* out of band data to be sent */ unsigned char outpad; /* keep structure word aligned */ }; struct ricstatbuf { char linestat[NPORTS][TOTAL_LSTATS]; struct { unsigned short cflag; unsigned char statinfo; unsigned char extstat; } lineinfo[NPORTS]; unsigned char command[NPORTS]; }; . k6$>O+4+-<>@./usr/include/sys/i386/ibmscsi.h#ifndef H_SCCSID #include #endif /* H_SCCSID */ H_SCCSID(kernel/scsi/drivers/common/ibmscsi.h, bos, 130, 0012 IBM) /* Modified: 14:14:09 3/29/93 */ /* * (C) Copyright IBM Corp. 1989,1990 * All Rights Reserved * Licensed Materials - Property of IBM */ /* * ibmscsi.h * * This file defines all of the various registers, bits and structures for * the SPOCK/TRIBBLE card. * * Author: * Guy G. Sotomayor, Jr. * IBM Corp. * Boca Raton, FL * (407) 982-7428 * VNET: GGS @ BCRVMPC2 * * Maintanence Log: * * Revision Date Who Description * -------- ------ ----- --------------------------------------------- * 0.00 8/20/89 GGS Moved from scsi.h * 0.01 8/14/91 TSB Model 57SX changes * */ /* * The following is the maximum number of micro-seconds that the card * should be busy. */ #define MAX_BUSY_DELAY 400 /* * Address Ranges for cards. */ #define MAX_IBM_CARDS 8 /* maximum number of cards */ #define MAX_IBM_DEVS 16 /* maximum number of card devs */ #define CARD_DEV 0x0F #define CARD_LUN 7 /* used only by driver */ #define IBM_SCSI_INT 14 #ifdef DEF_GLOBALS int ibm_io_addr[MAX_IBM_CARDS] = { 0x3540, 0x3548, 0x3550, 0x3558, 0x3560, 0x3568, 0x3570, 0x3578 }; #else extern int ibm_io_addr[]; #endif /* * Register Ports */ #define CMDR_LO 0 /* low 8 bits of command register */ #define CMDR_MEDL 1 /* middle low 8 bits of command register*/ #define CMDR_MEDH 2 /* middle high 8 bits of command reg */ #define CMDR_HI 3 /* high 8 bits of command register */ #define ATTNR 4 /* attention register */ #define BCR 5 /* basic control register */ #define ISR 6 /* interrupt status register */ #define BSR 7 /* basic status register */ /* * Definitions for Attention register (ATTNR) */ #define SIC (0x01 << 4) /* start immediate command */ #define SSCBC (0x03 << 4) /* start SCB command */ #define EOI (0x0E << 4) /* end of interrupt */ #define SLSCBC (0x0F << 4) /* start of long SCB command */ /* * Definitions for Basic Control register (BCR) */ #define AHR 0x80 /* attachment hardware reset */ #define EADMA 0x02 /* enable attachment DMA */ #define ENSI 0x01 /* enable system interrupts */ /* * Definitions for Interrupt Status register (ISR) */ #define ESCBCC_OK (0x01 << 4) /* SCB command complete success */ #define ESCBCC_RETRY (0x05 << 4) /* SCB cmd cmplt w/retries */ #define EAHF (0x07 << 4) /* Attachment hardware failure */ #define EICC (0x0A << 4) /* Immediate Command Complete */ #define ECC_FAIL (0x0C << 4) /* Command Complete w/ failure */ #define ECE (0x0E << 4) /* Command Error */ #define ESSE (0x0F << 4) /* Software Sequencing Error */ /* * Definitions for Basic Status register (BSR) */ #define CIRF 0x08 /* command interface registers full */ #define CIRE 0x04 /* command interface registers empty */ #define IREQ 0x02 /* interrupt request */ #define BUSY 0x01 /* attachment busy */ /* * SCSI Command Word Defintions (GEN) */ #define GEN_ND 0x00000080 /* No disconnect */ #define GEN_NS 0x00000040 /* Use async protocol */ #define GEN_RD 0x80000000 /* read from device to system */ #define GEN_WR 0x00000000 /* write from system to device */ #define GEN_ES 0x40000000 /* report TSB status on error only*/ #define GEN_RE 0x20000000 /* retry enable */ #define GEN_LIST 0x10000000 /* use scatter/gether */ #define GEN_SES 0x04000000 /* suppress exception short */ #define GEN_CACHE 0x00000000 /* allow caching */ #define GEN_NOCACHE 0x02000000 /* disable caching */ #define GEN_NOCHAIN 0x00000000 /* no chaining */ #define GEN_CHAIN 0x00010000 /* permit command chaining */ #define GEN_READ (GEN_RD | GEN_ES | GEN_RE) #define GEN_WRITE (GEN_WR | GEN_ES | GEN_RE) /* * SCB Commands */ #define SCB_IR 0x00 /* Immediate Reset */ #define SCB_RD 0x01 /* Read Data */ #define SCB_WR 0x02 /* Write Data */ #define SCB_RDVER 0x03 /* Read Verify */ #define SCB_WRVER 0x04 /* Write with Verify */ #define SCB_GCCS 0x07 /* Get command complete status */ #define SCB_RSCSIS 0x08 /* Request SCSI sense */ #define SCB_RDC 0x09 /* Read Device Capacity */ #define SCB_GPOS 0x0A /* Get POS and Adapter Information */ #define SCB_DINQ 0x0B /* Device Inquiry */ #define SCB_IFC 0x0C /* Immediate Feature Control */ #define SCB_PACE 0x0D /* Immediate DMA Pacing Control */ #define SCB_ASG 0x0E /* Immediate assign */ #define SCB_ABORT 0x0F /* Immediate abort */ #define SCB_WABT 0x10 /* write attachment buffer test */ #define SCB_RABT 0x11 /* read attachment buffer test */ #define SCB_IRDT 0x12 /* immediate run diagnostic test */ #define SCB_IRSST 0x13 /* immediate run selected self test */ #define SCB_GDSB 0x14 /* get diagnostic status block */ #define SCB_FU 0x16 /* format unit */ #define SCB_IFP 0x17 /* immediate format prepare */ #define SCB_RAB 0x18 /* re-assign block */ #define SCB_COPY 0x19 /* copy data */ #define SCB_MLBA 0x1A /* specify max LBA command */ #define SCB_RALRAM 0x1C /* read attachment local ram */ #define SCB_WALRAM 0x1D /* write attachment local ram */ #define SCB_OTHER 0x1F /* send other SCSI command */ #define SCB_TARGET 0x20 /* enable/end target mode */ #define CMD_IMMED 0x0400 #define CMD_SCB 0x1C00 #define CMD_CP 0x1E00 #define CMD_OTH 0x2400 #define CMD_ASSGN_TM 0x80000000 /* indicates assign for target mode */ #define CMD_UNASSIGN 0x00800000 /* reset the assignment */ /* * Immediate Commands */ #define CMD_RESET (SCB_IR | CMD_IMMED) #define CMD_ABORT (SCB_ABORT | CMD_IMMED) #define CMD_ASSIGN (SCB_ASG | CMD_IMMED) #define CMD_PACE (SCB_PACE | CMD_IMMED) #define CMD_IFC (SCB_IFC | CMD_IMMED) #define CMD_IFP (SCB_IFP | CMD_IMMED | 0x55AA0000) #define CMD_IRDT (SCB_IRDT | CMD_IMMED) #define CMD_IRSST (SCB_IRSST | CMD_IMMED) #define asgparms(lun,pun,dev) (((lun << 8) | (pun << 4) | dev) << 16) #define pacefctr(x) (x << 16) #define ftrctl(drate,gtimeout) (((drate << 13) | gtimeout) << 16) /* * SCSI Data Rates */ #define DR_400MB 0x01 /* 4.00 MB/s */ #define DR_333MB 0x02 /* 3.33 MB/s */ #define DR_286MB 0x03 /* 2.86 MB/s */ #define DR_250MB 0x04 /* 2.50 MB/s */ #define DR_222MB 0x05 /* 2.22 MB/s */ #define DR_200MB 0x06 /* 2.00 MB/s */ #define DR_182MB 0x07 /* 1.82 MB/s */ /* * SCB Commands */ #define CMD_READ (SCB_RD | CMD_SCB | GEN_READ) #define CMD_RDVER (SCB_RDVER | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_WRITE (SCB_WR | CMD_SCB | GEN_WRITE) #define CMD_WRVER (SCB_WRVER | CMD_SCB | GEN_WRITE) #define CMD_COPY (SCB_COPY | CMD_CP | GEN_ES | GEN_RE | GEN_NOCACHE) #define CMD_FU (SCB_FU | CMD_SCB | GEN_ES | GEN_RE | GEN_NOCACHE) #define CMD_RABLK (SCB_RAB | CMD_SCB | GEN_ES | GEN_RE | GEN_NOCACHE) #define CMD_MAXLBA (SCB_MLBA | CMD_SCB | GEN_ES | GEN_RE | GEN_NOCACHE) #define CMD_OTHER (SCB_OTHER | CMD_OTH | GEN_NOCACHE) #define CMD_GCCS (SCB_GCCS | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_SENSE (SCB_RSCSIS | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_GPOS (SCB_GPOS | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_GCAP (SCB_RDC | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_INQ (SCB_DINQ | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_RABT (SCB_RABT | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_WABT (SCB_WABT | CMD_SCB | GEN_WRITE | GEN_NOCACHE) #define CMD_RALRAM (SCB_RALRAM | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_WALRAM (SCB_WALRAM | CMD_SCB | GEN_WRITE | GEN_NOCACHE) #define CMD_GDSB (SCB_GDSB | CMD_SCB | GEN_READ | GEN_NOCACHE) #define CMD_TARGET ((SCB_TARGET | CMD_SCB | GEN_READ | GEN_NOCACHE) & ~GEN_ES) /* * Values / Masks for status/mode field in the target SCB command. */ #define SCB_TARG_EC 0x80 /* end of command */ #define SCB_TARG_RO 0x40 /* report over-runs */ #define SCB_TM_AUTO 0x01 /* Automatic mode */ #define SCB_TM_NON_INT 0x03 /* Non-Interactive mode */ #define SCB_TM_TRANS 0x02 /* Transparent mode */ #define SCB_TM_DISABLE 0x00 /* Disable target mode */ struct scb_args { ushort blk_count; ushort blk_length; }; /* * SCB */ struct scb { ulong cmd; daddr_t lba; paddr_t buff_adr; ulong bufflen; paddr_t tsb_adr; paddr_t scb_chain; union { struct scb_args cmd_args; struct scsi_0 cmd_other0; struct scsi_1 cmd_other1; struct scsi_5 cmd_other5; struct scsi_6 cmd_other6; } scb_args; }; typedef struct scb SCB; /* * Scatter/Gather block definition */ #define MAX_SCAT_GATH_ENTS 16 /* max len of scatter/gather list */ struct scat_gath_ent { paddr_t buff_adr; ulong buff_len; }; typedef struct scat_gath_ent SCAT_GATH_ENT; /* * Termination Status Block */ struct tsb { ushort scb_status; ushort retry_counts; ulong res_byte_count; paddr_t scat_gath_offset; ushort rem_len; /* this value == 12 */ uchar scsi_status; uchar cmd_status; uchar dev_error; uchar cmd_error; uchar diag_err_mod; ushort cache_info; paddr_t last_scb_adr; /* addr of last SCB processed */ }; typedef struct tsb TSB; /* * SCB Status Bit definitions */ #define SCBS_END 0x0001 /* SCB ended (no error) */ #define SCBS_SHORT 0x0002 /* Short record exception */ #define SCBS_CREJ 0x0004 /* Invalid command rejected */ #define SCBS_SREJ 0x0008 /* SCB rejected */ #define SCBS_SCHK 0x0010 /* SCB Specification check */ #define SCBS_LONG 0x0020 /* Long record exception */ #define SCBS_HALT 0x0040 /* SCB Halted (Error/End chain) */ #define SCBS_INTQ 0x0080 /* SCB Interrupt queued */ #define SCBS_ASTAT 0x0100 /* Additional Status available */ #define SCBS_DDSA 0x0200 /* Device dependent status available */ #define SCBS_DNI 0x0800 /* Device not initialized */ #define SCBS_MJEXCP 0x1000 /* Major exception occured */ /* * Retry count definitions */ #define RETRY_ARI 0x8000 /* attachment retry invoked */ #define RETRY_ABCR 0x0040 /* attachment buffer check retry */ #define RETRY_SICR 0x0020 /* system interface check retry */ #define RETRY_DFALT 0x0010 /* device fault retry */ #define get_num_retries(x) ((x)->retry_counts & 0x0007) #define get_scsi_status(x) (((x)->scsi_status & 0x001E) >> 1) /* * SCSI status codes */ #define SCSI_OK 0x00 /* good status (no error) */ #define SCSI_CHK 0x01 /* check condition (error) */ #define SCSI_BUSY 0x04 /* busy (command rejected) */ #define SCSI_INTOK 0x08 /* intermediate good (no error) */ #define SCSI_INTOK2 0x0A /* intermediate condition met (no error)*/ #define SCSI_RESCFLT 0x0C /* reservation conflict */ /* * SCSI command status codes */ #define CMDS_CCOK 0x01 /* command completed with success */ #define CMDS_CCOKR 0x05 /* command completed with retries */ #define CMDS_CPART 0x06 /* command partially complete */ #define CMDS_ADF 0x07 /* attachment diagnostic failure */ #define CMDS_ARCE 0x08 /* attention request code error */ #define CMDS_ABORTED 0x09 /* abort complete */ #define CMDS_DRC 0x0A /* device reset complete */ #define CMDS_EOIE 0x0B /* End of Interrupt Error */ #define CMDS_CCERR 0x0C /* Command completed with failure */ #define CMDS_DMAE 0x0D /* DMA error */ #define CMDS_SCBE 0x0E /* SCB Error */ #define CMDS_SEQ 0x0F /* command sequence error */ /* * Device Error Codes */ #define DEVE_OK 0x00 /* no error */ #define DEVE_RESET 0x01 /* SCSI bus reset */ #define DEVE_IFAULT 0x02 /* SCSI interface fault */ #define DEVE_SELTO 0x10 /* selection timeout */ #define DEVE_UBF 0x11 /* unexpected bus free */ #define DEVE_MMR 0x12 /* mandatory message rejected */ #define DEVE_INV_PHASE 0x13 /* Invalid SCSI Phase sequence */ #define DEVE_SLRE 0x20 /* Short Length Record Error */ /* * Command Error Codes */ #define CMDE_OK 0x00 /* no error */ #define CMDE_ISCBP 0x01 /* invalid SCB parameter */ #define CMDE_CNSUP 0x03 /* command not supported */ #define CMDE_CABTS 0x04 /* command aborted by system */ #define CMDE_CRJBT 0x05 /* command rejected - buffer test */ #define CMDE_CRJADF 0x06 /* command rejected - attch diag failed */ #define CMDE_FRMTRJ 0x07 /* format rejected - sequence error */ #define CMDE_ARJCIP 0x08 /* assign rejected - command in progress*/ #define CMDE_ARJDAA 0x09 /* assign rejected - device assigned */ #define CMDE_CRJNA 0x0A /* cmd rejected - dev not assigned */ #define CMDE_CRJMXLBA 0x0B /* cmd rejected - Max LBA exceeded */ #define CMDE_CRJADREX 0x0C /* cmd rejected - address range exceeded*/ #define CMDE_INVDEV 0x13 /* invalid device for command */ #define CMDE_AHWE 0x20 /* attachment hardware error */ #define CMDE_GLBLTO 0x21 /* global command timeout detected */ #define CMDE_DMAERR 0x22 /* DMA Error */ #define CMDE_BADBUFF 0x23 /* Attachment buffer failure */ #define CMDE_CABTC 0x24 /* command aborted by card */ /* * POS Information Status Block */ struct posisb { ushort card_id; uchar pos_reg3; uchar pos_reg2; uchar int_level; uchar pos_reg4; ushort rev_level; uchar luns_pdev; uchar max_devs; uchar pace_factr; uchar max_ldevs; uchar max_eoi2noi; uchar max_busy; ushort cache_status; ushort retry_status; }; #define SPOCK_ID 0x8EFF /* ID of SPOCK attachment */ #define TRIBBLE_ID 0x8EFE /* ID of TRIBBLE attachment */ #define MSP_SCSI_ID 0x8EFD /* ID of MSP's version of SPOCK */ #define MIDWAY_ID 0xFEE2 /* ID of Model 57SX planar */ #define CATCAY_ID 0xFEE6 /* ID of Model 56SX planar */ #define CANARY2_ID 0xFEE0 /* ID of Model 57 planar */ #define CANARY1_ID 0xFEE1 /* ID of Model 56 planar */ #define BERMUDA2_ID 0xFEDE /* ID of Model 77 planar */ #define BERMUDA1_ID 0xFEDF /* ID of Model 76 planar */ #define DUGOUT_ID 0xDCFF /* ID of DUGOUT planar, pp. 37 */ #define CORVETTE_ID 0x8EFC /* ID for corvette card */ /* * Definitions for POS reg 2 */ #define pos_romaddr(x) (((x) & 0xF0) >> 4) #define get_romaddr(x) pos_romaddr((x)->pos_reg2) #define ROM_C000 0x00 #define ROM_C200 0x01 #define ROM_C400 0x02 #define ROM_C600 0x03 #define ROM_C800 0x04 #define ROM_CA00 0x05 #define ROM_CC00 0x06 #define ROM_CE00 0x07 #define ROM_D000 0x08 #define ROM_D200 0x09 #define ROM_D400 0x0A #define ROM_D600 0x0B #define ROM_D800 0x0C #define ROM_DA00 0x0D #define ROM_DC00 0x0E #define pos_ioaddr(x) (((x) & 0x0E) >> 1) #define get_ioaddr(x) pos_ioaddr((x)->pos_reg2) #define AIO_3540 0x00 #define AIO_3548 0x01 #define AIO_3550 0x02 #define AIO_3558 0x03 #define AIO_3560 0x04 #define AIO_3568 0x05 #define AIO_3570 0x06 #define AIO_3578 0x07 #define pos_carden(x) ((x) & 0x01) #define get_carden(x) pos_carden((x)->pos_reg2) #define pos_scsiid(x) (((x) & 0xE0) >> 5) #define get_scsiid(x) pos_scsi_id((x)->pos_reg3) #define pos_is_fair(x) ((x) & 0x10) #define get_is_fair(x) pos_is_fair((x)->pos_reg3) #define pos_arblev(x) ((x) & 0x0F) #define get_arblev(x) pos_arblev((x)->pos_reg3) #define pos_romen(x) ((x) & 0x02) #define get_is_romen(x) pos_romen((x)->pos_reg4) /* * Definitions for revision level */ #define slot_size(x) (((x)->rev_level & 0xf000) >> 12) #define ucode_rev_level(x) ((x)->rev_level & 0x0fff) /* * Definitions for slot size. */ #define SCSI_IN_32 0 /* card is in a 32 bit slot */ #define SCSI_IN_16 1 /* card is in a 16 bit slot */ /* * uCode revision levels when Target mode is supported. */ #define SPOCK_TARGET_OK 6 /* level when target mode works */ #define TRIBBLE_TARGET_OK 0x10 /* level when target mode works */ /* * Format Unit Defect list block */ struct fudl { uchar reserved; uchar bck_ctl; uchar msb_list_len; uchar lsb_list_len; }; #define FU_BCKFMT 0x02 /* enables background formatting */ #define FU_SCB_FD 0x0010 /* defect list supplied */ #define FU_SCB_CL 0x0008 /* complete list supplied */ #define set_interleave(x) ((x) << 16) E_OK 0 k$ O++-8 ./usr/include/sys/i386/pos.hi.h/* * POS data for the PS/2 */ #ifndef H_SCCSID #include #endif /* ! H_SCCSID */ #ifndef _h_MACHINFO #ifdef KERNEL #include #else #include #endif #endif H_SCCSID(@(#)'kernel/i386.h/pos.h, bos, 130, 0012' 1.3 AIX) /* Modified: 07:59:52 3/3/93 */ /* * (C) Copyright IBM Corp. 1989 * All Rights Reserved * Licensed Materials - Property of IBM */ #ifndef _h_POS #define _h_POS #define MAX_IO_SLOTS 10 /* max number of slots in a PS/2 */ #define ISA_DEVSZ 12 /* buffer for ISA adapter data */ #define MAX_DRV_TAG 8 /* max length of ISA adapter id */ struct devdata { unsigned char pd_pos0; /* Card ID low */ unsigned char pd_pos1; /* Card ID high */ unsigned char pd_pos2; /* option select data byte 1 */ unsigned char pd_pos3; /* option select data byte 2 */ unsigned char pd_pos4; /* option select data byte 3 */ unsigned char pd_pos5; /* option select data byte 4 */ unsigned char pd_pos6; /* subaddress extention LSB */ unsigned char pd_pos7; /* subaddress extention MSB */ unsigned short pd_major; /* major dev */ unsigned short pd_flags; /* flags */ }; /* * POS constants in the 2k NVRAM */ #define NV_NUMSLOTS 0x018E #define NV_POS_SLOT_SIZE 0x0023 #define NV_POS_BASE 0x0000 #define NV_PLANAR_POS 0x0369 /* * PS/2 System Board POS register defines */ #define SYS_ENAB 0x94 /* System board enable / setup */ #define ADAP_ENAB 0x96 /* Adaptor board enable / setup */ #define POS_0 0x100 /* POS reg 0 - adaptor ID lsb */ #define POS_1 0x101 /* POS reg 1 - adaptor ID msb */ #define POS_2 0x102 /* Option Select Data byte 1 */ #define POS_3 0x103 /* Option Select Data byte 2 */ #define POS_4 0x104 /* Option Select Data byte 3 */ #define POS_5 0x105 /* Option Select Data byte 4 */ #define POS_6 0x106 /* Subaddress extension lsb */ #define POS_7 0x107 /* Subaddress extension msb */ #define SYS_ENABLE_SYSSETUP 0x80 /* system board setup enable bit */ #define SYS_ENABLE_VIDSETUP 0x20 /* video subsystem setup enable bit */ #define POS_2_EXT_PAR_ENAB 0x80 /* POS 2, extended parallel enable */ #define POS_2_PAR_ENAB 0x10 /* POS 2, parallel port enable */ #define POS_2_SERIAL_SEL 0x08 /* POS 2, serial port select */ #define POS_2_SERIAL_ENAB 0x04 /* POS 2, serial port enable */ #define POS_2_DISKETTE_ENAB 0x02 /* POS 2, diskette drive enable */ #define POS_2_SYS_BRD_ENAB 0x01 /* POS 2, system board enable */ #endif /* _h_POS */ efi kꪸ$wr+V+-w./usr/include/sys/if_slvar.hi.h#ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(@(#)kernel/43net.h/if_slvar.h, aix, 130, 0012 1.1 AIX) /* Modified: 18:35:53 3/24/93 */ /*- * Copyright (c) 1991 The Regents of the University of California. * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. All advertising materials mentioning features or use of this software * must display the following acknowledgement: * This product includes software developed by the University of * California, Berkeley and its contributors. * 4. Neither the name of the University nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE * ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF * SUCH DAMAGE. * * @(#)if_slvar.h 7.7 (Berkeley) 5/7/91 * * $Header: if_slvar.h,v 1.3 89/05/31 02:25:18 van Exp $ */ /* * (C) Copyright IBM Corp. 1993 * All Rights Reserved * Licensed Materials - Property of IBM */ #ifdef _KERNEL /* * Definitions for SLIP interface data structures * * (This exists so programs like slstats can get at the definition * of sl_softc.) */ struct sl_softc { struct ifnet sc_if; /* network-visible interface */ struct ifqueue sc_fastq; /* interactive output queue */ struct tty *sc_ttyp; /* pointer to tty structure */ u_char *sc_mp; /* pointer to next available buf char */ u_char *sc_ep; /* pointer to last available buf char */ u_char *sc_buf; /* input buffer */ u_int sc_flags; /* see below */ u_int sc_escape; /* =1 if last char input was FRAME_ESCAPE */ u_int sc_bytessent; u_int sc_bytesrcvd; long sc_lasttime; /* last time a char arrived */ long sc_starttime; /* last time a char arrived */ long sc_abortcount; /* number of abort esacpe chars */ struct sl_softc * free; /* points to next free elem if on free list */ #ifdef INET /* XXX */ struct slcompress sc_comp; /* tcp compression data */ #endif }; #endif /* _KERNEL */ /* visible flags */ #define SC_COMPRESS 0x0002 /* compress TCP traffic */ #define SC_NOICMP 0x0004 /* supress ICMP traffic */ #define SC_AUTOCOMP 0x0008 /* auto-enable TCP compression */ #define SC_DEBUG 0x0010 /* turn on debugging */ /* internal flags (should be separate) */ #define SC_ABORT 0x10000 /* have been sent an abort request */ /* this stuff doesn't belong here... */ #define SLIOCGFLAGS _IOR(D, 90, int) /* get configuration flags */ #define SLIOCSFLAGS _IOW(D, 89, int) /* set configuration flags */ #define SLIOCGUNIT _IOR(D, 88, int) /* get slip unit number */ #define SLIOCSIFMTU _IOW(D, 87, int) /* set interface mtu */ #define SLIOCSCLOSE _IOW(D, 86, int) /* close down the interface */ #define SLIPDISC 4 /* serial IP discipline */ j kJ7m$ r+U+-V ./usr/include/sys/if_types.hi.h#ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(@(#)kernel/43net.h/if_types.h, aix, 130, 0012 1.1 AIX) /* Modified: 18:35:51 3/24/93 */ /* @(#)97 1.2 com/inc/net/if_types.h, bos, bos320 6/7/91 10:10:29 */ /* * COMPONENT_NAME: (CMDNET) Interface types for parsing media address headers * * FUNCTIONS: if_types.h * * ORIGINS: 26, 27 * * (C) COPYRIGHT International Business Machines Corp. 1985, 1988 * All Rights Reserved * Licensed Material - Property of IBM * * US Government Users Restricted Rights - Use, duplication or * disclosure restricted by GSA ADP Schedule Contract with IBM Corp. * * Copyright (c) 1989 Regents of the University of California. * All rights reserved. * * Redistribution is only permitted until one year after the first shipment * of 4.4BSD by the Regents. Otherwise, redistribution and use in source and * binary forms are permitted provided that: (1) source distributions retain * this entire copyright notice and comment, and (2) distributions including * binaries display the following acknowledgement: This product includes * software developed by the University of California, Berkeley and its * contributors'' in the documentation or other materials provided with the * distribution and in all advertising materials mentioning features or use * of this software. Neither the name of the University nor the names of * its contributors may be used to endorse or promote products derived from * this software without specific prior written permission. * THIS SOFTWARE IS PROVIDED AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED * WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF * MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. * * @(#)if_types.h 7.3 (Berkeley) 6/28/90 */ /* * (C) Copyright IBM Corp. 1993 * All Rights Reserved * Licensed Materials - Property of IBM */ /* interface types for benefit of parsing media address headers */ #define IFT_OTHER 0x1 /* none of the following */ #define IFT_1822 0x2 /* old-style arpanet imp */ #define IFT_HDH1822 0x3 /* HDH arpanet imp */ #define IFT_X25DDN 0x4 /* x25 to imp */ #define IFT_X25 0x5 /* PDN X25 interface */ #define IFT_ETHER 0x6 /* Ethernet I or II */ #define IFT_ISO88023 0x7 /* CMSA CD */ #define IFT_ISO88024 0x8 /* Token Bus */ #define IFT_ISO88025 0x9 /* Token Ring */ #define IFT_ISO88026 0xa /* MAN */ #define IFT_STARLAN 0xb #define IFT_P10 0xc /* Proteon 10MBit ring */ #define IFT_P80 0xd /* Proteon 10MBit ring */ #define IFT_HY 0xe /* Hyperchannel */ #define IFT_FDDI 0xf #define IFT_LAPB 0x10 #define IFT_SDLC 0x11 #define IFT_T1 0x12 #define IFT_CEPT 0x13 #define IFT_ISDNBASIC 0x14 #define IFT_ISDNPRIMARY 0x15 #define IFT_PTPSERIAL 0x16 #define IFT_LOOP 0x18 /* loopback */ #define IFT_EON 0x19 /* ISO over IP */ #define IFT_XETHER 0x1a /* obsolete 3MB experimental ethernet */ #define IFT_NSIP 0x1b /* XNS over IP */ #define IFT_SLIP 0x1c /* IP over generic TTY */ stru kз$?P+ +﯄-W? X./usr/include/sys/ioctl.h.hi.h/* * IX/370 * 5667-126 * LICENSED MATERIALS - PROPERTY OF IBM * (c) Copyright 1985, 1986, 1989 IBM Corp. * (c) Copyright 1983, 1984, 1985, 1986, 1989 Locus Computing Corporation * All Rights Reserved */ #ifndef _POSIX_SOURCE #ifndef H_SCCSID #include #endif /* !H_SCCSID */ H_SCCSID(@(#)ioctl.h 1.2 IBM AIX) /* Modified: 20:01:56 7/15/92 */ #endif /* ! _POSIX_SOURCE */ #ifndef _H_IOCTL #define _H_IOCTL #ifndef _POSIX_SOURCE #include #include #include /* ** Structures definitions for ioctl args */ /* tty control character stuff */ struct tchars { char t_intrc; /* interrupt */ char t_quitc; /* quit */ char t_startc; /* start output */ char t_stopc; /* stop output */ char t_eofc; /* end-of-file */ char t_brkc; /* input delimiter (like nl) */ }; struct ltchars { char t_suspc; /* stop process signal */ char t_dsuspc; /* delayed stop process signal */ char t_rprntc; /* reprint line */ char t_flushc; /* flush output (toggles) */ char t_werasc; /* word erase */ char t_lnextc; /* literal next character */ }; struct ttypagestat { int tps_length; /* screen length (vertical) */ int tps_lpos; /* current vertical position */ char tps_statc; /* show system status info */ char tps_pagec; /* show next screenful */ char tps_pgoffc; /* ignore paging till next input */ char tps_flag; /* page the screen even in cbreak */ }; #ifdef _MBCS /* * define a codeset structure template */ struct tcset { u_short tdc_len; /* length of table to be read/written */ charlen_t tdc_codeset[CODESIZE]; }; #endif /* _MBCS */ /* Default control characters: Some of these defaults are duplicated in termio.h, namely, CUNDEF, CINTR, CQUIT, CEOF, CSTART, and CSTOP. If you change any of these (I really doubt that anyone will want to...), make sure that termio.h gets exact duplicates, otherwise cpp will complain about multiple definitions whenever we compile the kernel. */ #define CTRL(c) ('c'&037) #define CUNDEF 0377 #define CINTR 0177 /* DEL */ #define CQUIT 026 /* cntl v */ #define CEOF 04 /* cntl d */ #define CSTART 021 /* cntl q */ #define CSTOP 023 /* cntl s */ #define CEOT CEOF #define CBRK CUNDEF #define CSUSP CTRL(z) #define CDSUSP CTRL(y) #define CRPRNT CTRL(r) #define CFLUSH CTRL(o) #define CWERASE CTRL(w) #define CLNEXT CUNDEF #define CSTAT CTRL(t) #define CPAGE (' ') #define CPGOFF CTRL(m) /* disk partition stuff */ struct dkpart { long dk_numblks; /* number of sectors in partition */ long dk_cyloff; /* cylinder where partition starts */ }; /* disk partition table ioctl commands */ #define DKGETPART _IOR(d, 0, struct dkpart) /* get disk partition entry */ #define DKSETPART _IOW(d, 1, struct dkpart) /* set disk partition entry */ #endif /* ! _POSIX_SOURCE */ /* ** Ioctl commands: */ /* Window/terminal size structure. * This information is stored by the kernel * in order to provide a consistent interface, * but is not used by the kernel. * * Type are "unsigned short" so that types.h not required. */ #ifdef _POSIX_SOURCE struct _Winsize #else struct winsize #endif { unsigned short ws_row; /* rows, in characters */ unsigned short ws_col; /* columns, in characters */ unsigned short ws_xpixel; /* horizontal size, pixels */ unsigned short ws_ypixel; /* vertical size, pixels */ }; #ifndef _POSIX_SOURCE /* * Pun for SUN. */ struct ttysize { unsigned short ts_lines; unsigned short ts_cols; unsigned short ts_xxx; unsigned short ts_yyy; }; #define TIOCGSIZE TIOCGWINSZ #define TIOCSSIZE TIOCSWINSZ #ifndef NO_AUSTIN_HOOKS /* ******************************* AUSTIN HOOK ************************ */ struct hfscreen { unsigned short screen[25][80]; }; struct hfcurpos { unsigned short row; unsigned short column; }; /* subcodes for HFSKEP ioctl */ #define KEPOPEN 0x01 #define KEPCLOSE 0x02 #define KEPIOCTL 0x03 #define KEPREAD 0x04 #define KEPWRITE 0x05 #define KEPRDSLP 0x06 /* ******************************************************************** */ #endif /* file control ioctl commands */ #define FIOCLEX _ION(f, 1) /* set exclusive use on fd */ #define FIONCLEX _ION(f, 2) /* remove exclusive use */ #define FIOGETOWN _IOR(f, 123, int) /* 4.2: get owner */ #define FIOSETOWN _IOW(f, 124, int) /* 4.2: set owner */ #define FIOASYNC _IOW(f, 125, int) /* 4.2: set/clr async i/o */ #define FIONBIO _IOW(f, 126, int) /* 4.2: set/clr non-blk i/o */ #define FIONREAD _IOR(f, 127, long) /* get # bytes to read */ /* tty ioctl commands */ #define TIOCGETD _IOR(t, 0, int) /* get line discipline */ #define TIOCSETD _IOW(t, 1, int) /* set line discipline */ #define TIOCHPCL _ION(t, 2) /* hang up on last close */ #define TIOCMODG _IOR(t, 3, int) /* get modem control state */ #define TIOCMODS _IOW(t, 4, int) /* set modem control state */ #define TIOCM_LE 0001 /* line enable */ #define TIOCM_DTR 0002 /* data terminal ready */ #define TIOCM_RTS 0004 /* request to send */ #define TIOCM_ST 0010 /* secondary transmit */ #define TIOCM_SR 0020 /* secondary receive */ #define TIOCM_CTS 0040 /* clear to send */ #define TIOCM_CAR 0100 /* carrier detect */ #define TIOCM_RNG 0200 /* ring */ #define TIOCM_DSR 0400 /* data set ready */ #define TIOCM_RI TIOCM_RNG /* ring (alternate) */ #define TIOCM_CD TIOCM_CAR /* carrier detect (alternate) */ #define TIOCGETP _IOR(t, 8, struct sgttyb) /* get params -- gtty */ #define TIOCSETP _IOW(t, 9, struct sgttyb) /* set params -- stty */ #define TIOCSETN _IOW(t, 10, struct sgttyb) /* set, but no flushtty */ #define TIOCOSM _IOR(t, 11, int) /* osm logging allowed */ #define TIOCNOSM _IOR(t, 12, int) /* osm logging disallowed */ #define TIOCEXCL _ION(t, 13) /* set exclusive use of tty */ #define TIOCNXCL _ION(t, 14) /* reset exclusive use of tty */ #define TIOCFLUSH _IOW(t, 16, int) /* flush buffers */ #define TIOCSETC _IOW(t, 17, struct tchars) /* set special chars */ #define TIOCGETC _IOR(t, 18, struct tchars) /* get special chars */ #ifdef _MBCS #define TIOCSCLTBL 0x00007417 /* _IOW(t, 23) set codeset info. */ #define TIOCGCLTBL 0x00007418 /* _IOR(t, 24 get codeset info. */ #endif /* _MBCS */ #if defined(_BSD) && !defined(KERNEL) #define CRTBS 0x00010000 /* do backspacing for crt */ #define PRTERA 0x00020000 /* \ ... / erase */ #define CRTERA 0x00040000 /* " \b " to wipe out char */ #define TILDE 0x00080000 /* hazeltine tilde kludge */ #define MDMBUF 0x00100000 /* start/stop output on carrier intr */ #define LITOUT 0x00200000 /* literal output */ #define TOSTOP 0x00400000 /* SIGSTOP on background output */ #define FLUSHO 0x00800000 /* flush output to terminal */ #define NOHANG 0x01000000 /* no SIGHUP on carrier drop */ #define L001000 0x02000000 #define CRTKIL 0x04000000 /* kill line with " \b " */ #define PASS8 0x08000000 #define CTLECH 0x10000000 /* echo control chars as ^X */ #define PENDIN 0x20000000 /* tp->t_rawq needs reread */ #define DECCTQ 0x40000000 /* only ^Q starts after ^S */ #define NOFLSH 0x80000000 /* no output flush on signal */ #endif /* _BSD && !KERNEL */ #define TIOCLBIS _IOW(t, 127, int) /* bis local mode bits */ #define TIOCLBIC _IOW(t, 126, int) /* bic local mode bits */ #define TIOCLSET _IOW(t, 125, int) /* set entire local mode word */ #define TIOCLGET _IOR(t, 124, int) /* get local modes */ #define TIOCSBRK _ION(t, 123) /* set break bit */ #define TIOCCBRK _ION(t, 122) /* clear break bit */ #define TIOCSDTR _ION(t, 121) /* set data terminal ready */ #define TIOCCDTR _ION(t, 120) /* clear data terminal ready */ #define TIOCGPGRP _IOR(t, 119, long) /* get pgrp of tty */ #define TIOCSPGRP _IOW(t, 118, long) /* set pgrp of tty */ #define TIOCSLTC _IOW(t, 117, struct ltchars) /* set bsd special chars */ #define TIOCGLTC _IOR(t, 116, struct ltchars) /* get bsd special chars */ #define TIOCOUTQ _IOR(t, 115, int) /* output queue size */ #define TIOCSTI _IOW(t, 114, char) /* simulate terminal input */ #define TIOCNOTTY _ION(t, 113) /* void tty association */ #define TIOCPKT _IOW(t, 112, int) /* 4.2: pty: set/clr pkt mode */ #define TIOCPKT_DATA 0x00 /* data packet */ #define TIOCPKT_FLUSHREAD 0x01 /* flush packet */ #define TIOCPKT_FLUSHWRITE 0x02 /* flush packet */ #define TIOCPKT_STOP 0x04 /* stop output */ #define TIOCPKT_START 0x08 /* start output */ #define TIOCPKT_NOSTOP 0x10 /* no more ^S, ^Q */ #define TIOCPKT_DOSTOP 0x20 /* now do ^S ^Q */ #define TIOCSTOP _ION(t, 111) /* 4.2: stop output, like ^S */ #define TIOCSTART _ION(t, 110) /* 4.2: start output, like ^Q */ #define TIOCMSET _IOW(t, 109, int) /* set all modem bits */ #define TIOCMBIS _IOW(t, 108, int) /* bis modem bits */ #define TIOCMBIC _IOW(t, 107, int) /* bic modem bits */ #define TIOCMGET _IOR(t, 106, int) /* get all modem bits */ #define TIOCREMOTE _IOW(t, 105, int) /* 4.2: remote input editing */ #ifdef _POSIX_SOURCE #define TIOCGWINSZ _IOR(t, 104, struct _Winsize) /* get window size */ #define TIOCSWINSZ _IOW(t, 103, struct _Winsize) /* set window size */ #else #define TIOCGWINSZ _IOR(t, 104, struct winsize) /* get window size */ #define TIOCSWINSZ _IOW(t, 103, struct winsize) /* set window size */ #endif #define TIOCUCNTL _IOW(t, 102, int) /* pty set/clr usr cntrl mode */ #define UIOCCMD(n) _IO(u, n) /* usr cntl op "n" */ #define TIOCRESET _ION(t, 101) /* LCC: reset tty structure */ #define TIOCSCONS _ION(t, 104) /* 4.2: Select console line */ #define TIOCGPAGE _IOR(t, 64, struct ttypagestat) /* get page/stat info */ #define TIOCSPAGE _IOW(t, 65, struct ttypagestat) /* set page/stat info */ #define BBNTTNO (('b'<<8)|1) /* rfg:bbn tty empty? */ #define OTTYDISC 0 /* old, v7 std tty driver */ #define NETLDISC 1 /* line discip for berk net */ #define NTTYDISC 2 /* new tty discipline */ /* SPECIAL BSD/SYSV MERGE IOCTL COMMANDS */ /* the following two values are reserved and noted as such in termio.h */ #define TCSETPSX (TIOC|36) #define TCGETPSX (TIOC|37) /* * Additional tty mode flags for 4.[12] bsd */ #define LCRTBS 0000001 /* correct backspacing for crt */ #define LPRTERA 0000002 /* printing terminal \ ... / erase */ #define LCRTERA 0000004 /* do "\b \b" to wipe out character */ #define LTILDE 0000010 /* IIASA - hazeltine tilde kludge */ #define LMDMBUF 0000020 /* IIASA - start/stop output on carrier intr */ #define LLITOUT 0000040 /* IIASA - suppress any output translations */ #define LTOSTOP 0000100 /* send stop for any background tty output */ #define LFLUSHO 0000200 /* flush output sent to terminal */ #define LNOHANG 0000400 /* IIASA - don't send hangup on carrier drop */ #define LETXACK 0001000 /* IIASA - diablo style buffer hacking */ #define LCRTKIL 0002000 /* erase whole line on kill with "\b \b" */ #define LPASS8 0004000 /* allow all 8 bits to pass through on input */ #define LCTLECH 0010000 /* echo control characters as ^X */ #define LPENDIN 0020000 /* tp->t_rawq is waiting to be reread */ #define LDECCTQ 0040000 /* only ^Q starts after ^S */ #define LNOFLSH 0100000 /* disable flush after signal */ #define uclaltchars ttypagestat #define ut_length tps_length #define ut_lpos tps_lpos #define ut_statc tps_statc #define ut_pagec tps_pagec #define ut_npagec tps_pgoffc #define ut_pgcbrk tps_flag #define TIOGUCLA TIOCGPAGE #define TIOSUCLA TIOCSPAGE /* * Additional flags for terminal paging */ #define PGCBRK 0001 /* enable page-stop even in cbreak mode */ #define PGBELL 0002 /* ring bell on full page stop */ #define ERASBELL 0004 /* ring bell on attempted erase-past-prompt */ /* State bits don't really belong here, but shucks .... */ #define PAGESTOP 0010 /* state bit: tty is stopped on a full page */ #define PG0LPOS 0020 /* state bit: last page-start set t_lpos = 0 */ #define PG_ENB 0040 /* paging enabled (if length is also > 0) */ /* * General device I/O controls */ #define DIOCONLINE _ION(D, 0) /* turn device on-line */ #define DIOCOFFLINE _ION(D, 1) /* turn device off-line */ #define DIOCRESET _ION(D, 2) /* reset the device */ #ifdef b370 /* * 370 device I/O controls */ #define DEVADDR _ION(D, 100) /* virtual address of this device */ #endif /* b370 */ /* * osm device I/O controls */ #define OSMIOC_WRITE_ON _ION(O, 0) /* include console writes */ #define OSMIOC_WRITE_OFF _ION(O, 1) /* exclude console writes */ #define OSMIOC_ECHO_ON _ION(O, 2) /* include input echoes */ #define OSMIOC_ECHO_OFF _ION(O, 3) /* exclude input echoes */ /* socket i/o controls */ #define SIOCSHIWAT _IOW(s, 0, int) /* set high watermark */ #define SIOCGHIWAT _IOR(s, 1, int) /* get high watermark */ #define SIOCSLOWAT _IOW(s, 2, int) /* set low watermark */ #define SIOCGLOWAT _IOR(s, 3, int) /* get low watermark */ #define SIOCATMARK _IOR(s, 7, int) /* at oob mark? */ #define SIOCSPGRP _IOW(s, 8, int) /* set process group */ #define SIOCGPGRP _IOR(s, 9, int) /* get process group */ #define SIOCADDRT _IOW(r, 10, struct rtentry) /* add route */ #define SIOCDELRT _IOW(r, 11, struct rtentry) /* delete route */ #define SIOCSIFADDR _IOW(i, 12, struct ifreq) /* set ifnet address */ #define SIOCGIFADDR _IOWR(i,13, struct ifreq) /* get ifnet address */ #define SIOCSIFDSTADDR _IOW(i, 14, struct ifreq) /* set p-p address */ #define SIOCGIFDSTADDR _IOWR(i,15, struct ifreq) /* get p-p address */ #define SIOCSIFFLAGS _IOW(i, 16, struct ifreq) /* set ifnet flags */ #define SIOCGIFFLAGS _IOWR(i,17, struct ifreq) /* get ifnet flags */ #define SIOCGIFBRDADDR _IOWR(i,18, struct ifreq) /* get broadcast addr */ #define SIOCSIFBRDADDR _IOW(i,19, struct ifreq) /* set broadcast addr */ #define SIOCGIFCONF _IOWR(i,20, struct ifconf) /* get ifnet list */ #define SIOCGIFNETMASK _IOWR(i,21, struct ifreq) /* get net addr mask */ #define SIOCSIFNETMASK _IOW(i,22, struct ifreq) /* set net addr mask */ #define SIOCGIFMETRIC _IOWR(i,23, struct ifreq) /* get IF metric */ #define SIOCSIFMETRIC _IOW(i,24, struct ifreq) /* set IF metric */ #define SIOCGIFMTU _IOWR(i,25, struct ifreq) /* get IF mtu */ #define SIOCSIFMTU _IOW(i,26, struct ifreq) /* set IF mtu */ #define SIOCGIFREMMTU _IOWR(i,27, struct ifreq) /* get IF remmtu */ #define SIOCSIFREMMTU _IOW(i,28, struct ifreq) /* set IF remmtu */ #define SIOCSARP _IOW(i, 30, struct arpreq) /* set arp entry */ #define SIOCGARP _IOWR(i,31, struct arpreq) /* get arp entry */ #define SIOCDARP _IOW(i, 32, struct arpreq) /* delete arp entry */ #define SIOCSIFIUCV _IOW(i, 33, struct ifreq) /* set iucv state */ #define SIOCGIFIUCV _IOWR(i,34, struct ifreq) /* get iucv state */ #define SIOCSARP_802_5 _IOW(i, 93, struct ie5_arpreq) /* set arp entry */ #define SIOCGARP_802_5 _IOWR(i,94, struct ie5_arpreq) /* get arp entry */ #define SIOCDARP_802_5 _IOW(i, 95, struct ie5_arpreq) /* delete arp entry */ #define IOCTYPE 0xff00 #define IOCINFO 0xff01 #define IOCCONFIG 0xff02 #define IOCSTATS 0xff03 #ifdef b370 #define HDIORST _ION(F,75) /* reset driver (re-read vtoc) */ #define HDIOPAR _ION(F,76) /* get drive information (fba_dev) */ #endif #ifdef i386 /* Floppy/Micro diskette control */ #define FDIO ('F' << 8) #define FDFMTON (FDIO|1) /* formatting on */ #define FDFMTOFF (FDIO|2) /* formatting off */ #define FDVERIFY (FDIO|3) /* enable last byte read back verify */ #define FDNOVERIFY (FDIO|4) /* disable last byte read back verify */ /* Hard disk control */ #define HDIO ('H' << 8) #define HDIORST (HDIO|1) /* hard disk reset */ #define HDIOPAR (HDIO|2) /* hard disk parameters */ #define HDIOSTAT (HDIO|9) /* hard disk partition open status */ #define HDSETERRSCAN (HDIO|10) /* set "scanning for errors" mode */ #define HDCLRERRSCAN (HDIO|11) /* clear "scanning for errors" mode */ #define HDNUMDISKS _IOR(H,12,int) /* get the max number of disks supported */ #include /* CRT related ioctls in their own module */ #endif /* i386 */ #endif /* !_POSIX_SOURCE */ #ifdef i386 /* ioctl commmands for posdev driver */ #define PIOC_PROC_MODEL_INFO _IOR(p,1,struct model_info) #define PIOCMACHINFO _IOR(p,0,struct mach_info) #endif /* i386 */ #endif /* ~_H_IOCTL */ /* ==================================================================== */ #define TIOMOUSEON _ION(t, 98) #define TIOMOUSEOFF _ION(t, 99) /* ==================================================================== */ cont k꺄{$P++﯄-+ ./usr/include/sys/machinfo.hi.h/* * 5713-AEQ COPYRIGHT IBM CORP 1989 * LICENSED MATERIAL - PROGRAM PROPERTY OF IBM */ /* * (c) Copyright 1987, 1989 Locus Computing Corporation * All Rights Reserved * * this file defines information that can be used to figure out what * sort of machine and configuration we are running on. It is intended * to be used in kernels that are supposed to run on multiple different * models of fundamentally similar machines. * * for any given architecture, the particular macros and values are * highly machine dependent, but the notion of having this sort of * information is probably machine independent */ /* * (C) Copyright IBM Corp. 1989 * All Rights Reserved * Licensed Materials - Property of IBM */ #ifndef H_SCCSID #include #endif /* ~H_SCCSID */ H_SCCSID(@(#)'kernel/mi.h/machinfo.h, bos, 130, 0012' 1.5 AIX) /* Modified: 16:50:58 3/3/93 */ #ifndef _h_MACHINFO #define _h_MACHINFO /* Type declaration for mach_info structrue */ extern struct mach_info { long mach_type; /* type of CPU and box */ long mach_options; /* special options on this processor */ long cpu_level; /* CPU revision level */ long mach_level; /* machine revision level */ long mach_serial; /* machine serial number */ } mach_info; struct model_info { char model_info_model; char model_info_submodel; }; #ifdef i386 #ifndef KERNEL /* function in librts that fills mach_info structure */ extern int _get_mach_info(); /* * Macro to initialize mach_info structure so macros work in * system and application programs. */ #define GET_MACH_INFO() _get_mach_info() #endif /* !KERNEL */ /* macros to make sense out of a PC machine type */ #define PC_BOX(cpu,arch,model) ((cpu << 16L) + (arch << 8) + model) #define PC_CPU(type) ((type >> 16) & 0xffff) #define PC_ARCH(type) ((type >> 8) & 0xff) #define PC_MODEL(type) (type & 0xff) /* defined PC machine types */ #define PC_AT PC_BOX( 286, 1, 0 ) /* PC/AT */ #define PC_386 PC_BOX( 386, 1, 0 ) /* 386 AT clones */ #define PS2_50 PC_BOX( 286, 2, 50 ) /* PS/2 model 50 */ #define PS2_55 PC_BOX( 386, 2, 55 ) /* PS/2 model 55, not PS/55 */ #define PS2_57_OR_56 PC_BOX( 386, 2, 57 ) /* PS/2 model 57 OR 56 */ #define PS2_60 PC_BOX( 286, 2, 60 ) /* PS/2 model 60 */ #define PS2_70 PC_BOX( 386, 2, 70 ) /* PS/2 model 70 */ #define PS2_77_OR_76 PC_BOX( 386, 2, 77 ) /* PS/2 model 77 OR 76 */ #define PS2_80 PC_BOX( 386, 2, 80 ) /* PS/2 model 80 */ #define PS2_90 PC_BOX( 386, 2, 90 ) /* PS/2 model 90 */ #define PS2_95 PC_BOX( 386, 2, 95 ) /* PS/2 model 95 */ #define PS2_52 PC_BOX( 386, 2, 52 ) /* PS/2 model 9552 (thinkpad) */ #define PS2_35 PC_BOX( 386, 1, 35 ) /* PS/2 model 35 OR 40 */ /* options that can be associated with a machine */ #define OPT_2KNVRAM 0x00000001 /* this machine has 2K nvram */ #define OPT_TIMER_LATCH 0x00000002 /* timer 0 latch, such as MCA machine */ #define OPT_DELAY_PORT 0x00000004 /* I/O delay port on some PS/2s */ #define OPT_PS2_MOUSE 0x00000008 /* PS/2 type mouse port */ #define OPT_PS2_ISABUS 0x00000010 /* PS/2 ISA bus machine */ #define TYP_MICRO_CHAN 0x00000200 /* Micro Channel architecture */ /* macros to answer basic questions about '86 boxes */ #define HAS_2K_NVRAM() (mach_info.mach_options & OPT_2KNVRAM) #define HAS_TIMER_LATCH() (mach_info.mach_options & OPT_TIMER_LATCH) #define HAS_DELAY_PORT() (mach_info.mach_options & OPT_DELAY_PORT) #define HAS_PS2_MOUSE() (mach_info.mach_options & OPT_PS2_MOUSE) #define HAS_PS2_ISABUS() (mach_info.mach_options & OPT_PS2_ISABUS) #define HAS_MICRO_CHAN() (mach_info.mach_type & TYP_MICRO_CHAN) /* macros for 386 chip levels */ #define B1_386 (0x303) /* dh,dl id bytes for 80386 B1 step */ #define C0_386 (0x304) /* dh,dl id bytes for 80386 C0 step */ #endif /* i386 */ #endif /* !_h_MACHINFO */ * ~_H kiy$Js+V+﯄-FJB[./usr/include/sys/slcompress.hh#ifndef H_SCCSID #include #endif /* ! H_SCCSID */ H_SCCSID(@(#)kernel/43net.h/slcompress.h, aix, 130, 0012 1.1 AIX) /* Modified: 18:35:55 3/24/93 */ /* slcompress.h 7.4 90/06/28 */ /* * Definitions for tcp compression routines. * * $Header: slcompress.h,v 1.10 89/12/31 08:53:02 van Exp $ * * Copyright (c) 1989 Regents of the University of California. * All rights reserved. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in the * documentation and/or other materials provided with the distribution. * 3. All advertising materials mentioning features or use of this software * must display the following acknowledgement: * This product includes software developed by the University of * California, Berkeley and its contributors. * 4. Neither the name of the University nor the names of its contributors * may be used to endorse or promote products derived from this software * without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND * ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE * ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE * FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL * DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS * OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT * LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY * OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF * SUCH DAMAGE. * * Van Jacobson (van@helios.ee.lbl.gov), Dec 31, 1989: * - Initial distribution. */ /* * (C) Copyright IBM Corp. 1993 * All Rights Reserved * Licensed Materials - Property of IBM */ #define MAX_STATES 16 /* must be > 2 and < 256 */ #define MAX_HDR MLEN /* XXX 4bsd-ism: should really be 128 */ /* * Compressed packet format: * * The first octet contains the packet type (top 3 bits), TCP * 'push' bit, and flags that indicate which of the 4 TCP sequence * numbers have changed (bottom 5 bits). The next octet is a * conversation number that associates a saved IP/TCP header with * the compressed packet. The next two octets are the TCP checksum * from the original datagram. The next 0 to 15 octets are * sequence number changes, one change per bit set in the header * (there may be no changes and there are two special cases where * the receiver implicitly knows what changed -- see below). * * There are 5 numbers which can change (they are always inserted * in the following order): TCP urgent pointer, window, * acknowlegement, sequence number and IP ID. (The urgent pointer * is different from the others in that its value is sent, not the * change in value.) Since typical use of SLIP links is biased * toward small packets (see comments on MTU/MSS below), changes * use a variable length coding with one octet for numbers in the * range 1 - 255 and 3 octets (0, MSB, LSB) for numbers in the * range 256 - 65535 or 0. (If the change in sequence number or * ack is more than 65535, an uncompressed packet is sent.) */ /* * Packet types (must not conflict with IP protocol version) * * The top nibble of the first octet is the packet type. There are * three possible types: IP (not proto TCP or tcp with one of the * control flags set); uncompressed TCP (a normal IP/TCP packet but * with the 8-bit protocol field replaced by an 8-bit connection id -- * this type of packet syncs the sender & receiver); and compressed * TCP (described above). * * LSB of 4-bit field is TCP "PUSH" bit (a worthless anachronism) and * is logically part of the 4-bit "changes" field that follows. Top * three bits are actual packet type. For backward compatibility * and in the interest of conserving bits, numbers are chosen so the * IP protocol version number (4) which normally appears in this nibble * means "IP packet". */ /* packet types */ #define TYPE_IP 0x40 #define TYPE_UNCOMPRESSED_TCP 0x70 #define TYPE_COMPRESSED_TCP 0x80 #define TYPE_ERROR 0x00 /* Bits in first octet of compressed packet */ #define NEW_C 0x40 /* flag bits for what changed in a packet */ #define NEW_I 0x20 #define NEW_S 0x08 #define NEW_A 0x04 #define NEW_W 0x02 #define NEW_U 0x01 /* reserved, special-case values of above */ #define SPECIAL_I (NEW_S|NEW_W|NEW_U) /* echoed interactive traffic */ #define SPECIAL_D (NEW_S|NEW_A|NEW_W|NEW_U) /* unidirectional data */ #define SPECIALS_MASK (NEW_S|NEW_A|NEW_W|NEW_U) #define TCP_PUSH_BIT 0x10 /* * "state" data for each active tcp conversation on the wire. This is * basically a copy of the entire IP/TCP header from the last packet * we saw from the conversation together with a small identifier * the transmit & receive ends of the line use to locate saved header. */ struct cstate { struct cstate *cs_next; /* next most recently used cstate (xmit only) */ u_short cs_hlen; /* size of hdr (receive only) */ u_char cs_id; /* connection # associated with this state */ u_char cs_filler; union { char csu_hdr[MAX_HDR]; struct ip csu_ip; /* ip/tcp hdr from most recent packet */ } slcs_u; }; #define cs_ip slcs_u.csu_ip #define cs_hdr slcs_u.csu_hdr /* * all the state data for one serial line (we need one of these * per line). */ struct slcompress { struct cstate *last_cs; /* most recently used tstate */ u_char last_recv; /* last rcvd conn. id */ u_char last_xmit; /* last sent conn. id */ u_short flags; #ifndef SL_NO_STATS int sls_packets; /* outbound packets */ int sls_compressed; /* outbound compressed packets */ int sls_searches; /* searches for connection state */ int sls_misses; /* times couldn't find conn. state */ int sls_uncompressedin; /* inbound uncompressed packets */ int sls_compressedin; /* inbound compressed packets */ int sls_errorin; /* inbound unknown type packets */ int sls_tossed; /* inbound packets tossed because of error */ #endif struct cstate tstate[MAX_STATES]; /* xmit connection states */ struct cstate rstate[MAX_STATES]; /* receive connection states */ }; /* flag values */ #define SLF_TOSS 1 /* tossing rcvd frames because of input err */ extern void sl_compress_init(/* struct slcompress * */); extern u_char sl_compress_tcp(/* struct mbuf *, struct ip *, struct slcompress *, int compress_cid_flag */); extern int sl_uncompress_tcp(/* u_char **, int, u_char, struct slcompress * */); ge per k*$T+ +﯄-./usr/lib/llib-lc.lnomp+llib-lc.c$accessBaccessB$acctBacctB.alarmBalarmB$brkBbrkBbsbrkBsbrkB $chdirB chdirB"$chmodB"chmodB$$chownB$chownB&$chrootB&chrootB($closeB(closeB)$closexB)closexB+$creat B+creat B-$dupB-dupB/RenvironB1$execlB1execlB2$execvR'B2execv'B4$execle/B4execle/B5$execveRR6B5execve6B7$execlp=B7execlp=B8$execvpRDB8execvpDB: exitKB; _exitPB=%fclearVB=fclearVB?$fcntl_B?fcntl_BA$forkgBAforkgBC$fsynclBCfsynclBE$ftruncaterBEftruncaterBG$getgroups|BGgetgroups|BI%getpidBIgetpidBJ%getpgrpBJgetpgrpBK%getppidBKgetppidBM-getuidBM getuidBN-geteuidBN geteuidBO-getgidBO getgidBP-getegidBP getegidBS$ioctlBSioctlBT$ioctlxBTioctlxBV$killBVkillBX$linkBXlinkBZ$lockfBZlockfB\%lseekB\lseekB^$mknodB^mknodB`$mountB`mountBb$msgctl BbmsgctlBd$msggetBdmsggetBf$msgsnd CfmsgsndCg$msgrcv  Cgmsgrcv Ch$msgxrcv@ ChmsgxrcvCj$niceCjniceCm$openCmopenCn$openx$Cnopenx$Cp$pause*Cppause*Cr$pipe0Crpipe0Ct$plock5Ctplock5Cv profil;Cx$ptraceBCxptraceBCz$readICzreadIC{$readxNC{readxNC}$rebootTC$removeBremoveB$renameBrenameB$semctloCsemctloC$semgetvCsemgetvC$semop@}Csemop}C$setgroupsCsetgroupsC$setpgrpCsetpgrpC$setpgidCsetpgidC$setuidCsetuidC$setgidCsetgidC$shmctl XCshmctlXC$shmget_Cshmget_CbshmatfCshmatfC$shmdtlCshmdtlC$sigblockBsigblockB`signal`Bsignal`B$sigpause3Bsigpause3B$sigsetmask(Bsigsetmask(B$sigstackBsigstackB$sigvec``BsigvecB$statCstatC$fstatCfstatC$stimeCstimeC syncC%timeCtimeC%times Ctimes C%ulimitCulimitC/umaskCumaskC$umountCumountC$unamePCunamePC$unamexlCunamexlC$unlinksCunlinksC$usrinfozCusrinfozC$ustat CustatC$utimeaCutimeC%waitCwaitC$writeCwriteC$writexCwritexC%a64lCa64lCbl64aCl64aC$abortCabortC$absCabsC _assertCbbsearchCbsearchC$toupperCtoupperC$tolowerCtolowerC$_toupper C_toupper C$_tolowerC_tolowerC$toasciiCtoasciiC%clock%Cclock%Cbcrypt+Ccrypt+C setkey1C encrypt8CbctermidwBctermidwBbctime@Cctime@ChlocaltimeClocaltimeChgmtimeCgmtimeCbasctimeCasctimeC tzsetCtimezone]CdaylightCrtznameC_NLctabZCbNLctimeCNLctimeCbNLasctimeCNLasctimeC$isalphasCisalphasC$isupper{Cisupper{C$islowerCislowerC $isdigitC isdigitC $isxdigitC isxdigitC $isalnumC isalnumC $isspaceC isspaceC $ispunctC ispunctC$isprintCisprintC$isgraphCisgraphC$iscntrlCiscntrlC$isasciiCisasciiC2_ctypeCbcuseridBcuseridB'drand48Cdrand48C'erand48Cerand48C%lrand48Clrand48C%nrand48Cnrand48C%mrand48Cmrand48C%jrand48Cjrand48C  srand48 C!mseed48C!seed48C" lcong48C$becvt"C$ecvt"C%bfcvt'C%fcvt'C&bgcvt,C&gcvt,C(end1C(etext5C(edata;C*$fclose!B*fcloseB+$fflush!B+fflushB1$feof!AC1feofAC2$ferror!FC2ferrorFC3 clearerr!MC4$fileno!VC4filenoVC6h!fopen9B6!fopen9B7h!freopen!FB7!freopenFB8h!fdopen?B8!fdopen?B;$fread!B;freadB<$fwrite!B<fwriteB>'frexp]C>frexp]C?'ldexpcC?ldexpcC@'modfiC@modfiCB$fseek!BBfseekBC%ftell!cBCftellcBD rewind!iBF$ftwnCFftwnCJ$getc!rCJgetcrCK$getcharwCKgetcharwCL$fgetc!BLfgetcBM$getw!CMgetwCObgetcwdCOgetcwdCQbgetenvCQgetenvCSbNLgetenvCSNLgetenvCWhgetgrentCWgetgrentCXhgetgrgidCXgetgrgidCYhgetgrnamCYgetgrnamCZ setgrentC[ endgrentC\hfgetgrent!C\fgetgrentC^bgetloginC^getloginC`$getoptRC`getoptCaoptarg CboptindCcopterrCdoptopt"Cfbgetpass)Cfgetpass)Ch$getpwBBhgetpwBBjh getpwentZBj getpwentZBkh getpwuidBk getpwuidBlh getpwnam Bl getpwnam Bm setpwentHBn endpwentQBoh fgetpwent!1Co fgetpwent1CqbgetsBqgetsBrbfgets!BrfgetsBuhhsearch CuhsearchCv$hcreateCvhcreateCw hdestroyCy l3tolCz ltol3C~blsearchC~lsearchCblfindClfindCbmallocCmallocC freeBbreallocCreallocCbcallocCcallocCbmemccpyCmemccpyCbmemchrCmemchrC$memcmpCmemcmpCbmemcpyCmemcpyCbmemsetCmemsetCbmktempCmktempC monitorCoNCstrcatCNCstrcatCoNCstrncatCNCstrncatC$NCstrcmpCNCstrcmpC$NCstrncmpCNCstrncmpCoNCstrcpyCNCstrcpyCoNCstrncpyCNCstrncpyC$NCstrlenCNCstrlenCoNCstrchrCNCstrchrCoNCstrrchrCNCstrrchrCoNCstrpbrk CNCstrpbrk C$NCstrspnCNCstrspnC$NCstrcspnCNCstrcspnCoNCstrtok&CNCstrtok&C/NCdechrHBNCdechrHB$NCdec/CNCdec/C$_NCdec29C_NCdec29C$NCencGCNCencGC$NCchrlenMCNCchrlenMC$NLisNLcpVCNLisNLcpVC$NLchrlen_CNLchrlen_C$NCdecodehCNCdecodehC$NCdecstrqCNCdecstrqC$NCencode~CNCencode~C$NCencstrCNCencstrC$NCcollateCNCcollateC$NCcoluniqCNCcoluniqC$NCeqvmapCNCeqvmapC$_NCxcol__C_NCxcolC$_NLxcolR_C_NLxcolC$NCisshiftCNCisshiftC$NCisalphaCNCisalphaC$NCisupperCNCisupperC$NCislowerCNCislowerC$NCisdigitCNCisdigitC$NCisxdigitCNCisxdigitC$NCisalnum CNCisalnum C$NCisspaceCNCisspaceC$NCispunctCNCispunctC$NCisprint'CNCisprint'C$NCisgraph1CNCisgraph1C$NCiscntrl;CNCiscntrl;C$NCisNLcharECNCisNLcharEC$_NCtoupperPC_NCtoupperPC$_NCtolower[C_NCtolower[C$NCflatchrfCNCflatchrfC$NCtoNLcharpCNCtoNLcharpC$NCesc{CNCesc{C$NCunescCNCunescC$NCtolowerCNCtolowerC$NCtoupperCNCtoupperC$NLescstrCNLescstrC$NLflatstrCNLflatstrC$NLunescstrCNLunescstrC$nlistCnlistCbNLstrcathCNLstrcathCbNLstrncatqCNLstrncatqC$NLstrcmp{CNLstrcmp{C$NLstrncmpCNLstrncmpCbNLstrcpyCNLstrcpyCbNLstrncpyCNLstrncpyC$NLstrlenCNLstrlenC$NLstrdlenCNLstrdlenCbNLstrchrCNLstrchrCbNLstrrchrCNLstrrchrCbNLstrpbrkCNLstrpbrkC$NLstrspnCNLstrspnC$NLstrcspnCNLstrcspnCbNLstrtokCNLstrtokCbNLstrtime)CNLstrtime)C$NLtmtimeCNLtmtimeC perrorBerrnoCrsys_errlistPCsys_nerr PCh!popenNB!popenNB$pclose!PCpclosePC $printfB printfB $fprintf!B fprintfB$sprintfBsprintfB$NLprintfPCNLprintfPC$NLfprintf!%PCNLfprintf%PC$NLsprintf/PCNLsprintf/PC$putc!9PCputc9PC$putchar>PCputchar>PC$fputc!BfputcB$putw!FPCputwFPC$putenvKPCputenvKPC!$putpwent !RPC!putpwentRPC#$putsB#putsB$$fputs!B$fputsB& qsort[PC( srandaPC)$randgPC)randgPC-$scanfB-scanfB/$fscanf!B/fscanfB1$sscanfB1sscanfB4$NLscanflPC4NLscanflPC6$NLfscanf!tPC6NLfscanftPC8$NLsscanf}PC8NLsscanf}PC; setbuf!pB<$setvbuf! B<setvbuf B?$setjmpPC?setjmpPC@ longjmpPCB.sleepPCBsleepPCDdssignalPCDssignalPCE$gsignalPCEgsignalPCG8!_iobBBH|_bufendtabPCJ%ftokPCJftokPCLbstrcatPCLstrcatPCMbstrncatPCMstrncatPCN$strcmpPCNstrcmpPCO$strncmpQCOstrncmpQCPbstrcpyQCPstrcpyQCQbstrncpyQCQstrncpyQCR$strlenQCRstrlenQCSbstrchrQCSstrchrQCTbstrrchr%QCTstrrchr%QCUbstrpbrk-QCUstrpbrk-QCV$strspn5QCVstrspn5QCW$strcspn$dosread0B>dosread0BA$dosrename:BAdosrename:BD$dosreopenTBDdosreopenTBG$dosrmdir^BGdosrmdir^BK$dosseekgBKdosseekgBN$dosstatzBNdosstatzBQ$dostouchBQdostouchBT$dosunlinkBTdosunlinkBW$dosunopenBWdosunopenBZ$dosustata BZdosustatB^$doswriteB^doswrite kpq$jT+$+﯄-j./usr/lib/llib-lm.lnnp+llib-lm.c'j0Bj0B'j1Bj1B 'jnB jnB 'y0B y0B 'y1B y1B 'ynB ynB'erfBerfB'erfcBerfcB'expBexpB'log!Blog!B'log10%Blog10%B'pow6Bpow6B'sqrt:Bsqrt:B'floorIBfloorIB'ceilOBceilOB'fmodYBfmodYB'fabs^Bfabs^B'gammaBgammaBsigngamB'hypotBhypotB!$matherr B!matherrB#'sinhB#sinhB$'coshB$coshB%'tanhB%tanhB''sincB'sincB('cosgB(cosgB)'tankB)tankB*'asinoB*asinoB+'acostB+acostB,'atanyB,atanyB-'atan2~B-atan2~B0'copysignB0copysignat k$T+%+﯄-./usr/lib/llib-lmalloc.lnss.hh+llib-lmalloc.c $malloptjB malloptjB (@mallinfoB @mallinfo k꠱$T+'+-./usr/lib/llib-port.lnl+llib-port.c exithA _exithA dsignalhA signalhA %timehA timehA$unlinkhAunlinkhA$aborthAaborthA$abshAabshA _asserhA$touppehAtouppehA$tolowehAtolowehA$_toupphA_toupphA$_tolowhA_tolowhA$toascihAtoascihA!%clockhA!clockhA#bcrypthA#crypthA$ setkeyhA% encryphA'bctermihA'ctermihA)bctimehA)ctimehA+hP localthA+P localthA,hP gmtimehA,P gmtimehA-basctimP hA-asctimhA. tzsethA/timezohA0daylighA1rtznamehA?$isalphhA?isalphhA@$isuppehA@isuppehAA$islowehAAislowehAB$isdigihABisdigihAC$isxdighACisxdighAD$isalnuhADisalnuhAE$isspachAEisspachAF$ispunchAFispunchAG$isprinhAGisprinhAH$isgraphAHisgraphAI$iscntrhAIiscntrhAJ$isascihAJisascihAK2_ctypehAMbcuserihAMcuserihAO'drand4hAOdrand4hAP'erand4hAPerand4hAQ%lrand4hAQlrand4hAR%nrand4hARnrand4hAS%mrand4hASmrand4hAT%jrand4hATjrand4hAU srand4hAVmseed48hAW lcong4hAY$fclosehAYfclosehAZ$fflushhAZfflushhA`$feofhA`feofhAa$ferrorhAaferrorhAb clearehAc$filenohAcfilenohAehfopenhAefopenhAfhfreopehAffreopehAh$freadhAhfreadhAi$fwritehAifwritehAk'frexphAkfrexphAl'ldexphAlldexphAm'modfhAmmodfhAo$fseekhAofseekhAp%ftellhApftellhAq rewindhAu$getchAugetchAv$getchahAvgetchahAw$fgetchAwfgetchAx$getwhAxgetwhAz$getoptRhAzgetopthA{optarghA|optindhA}opterrhA}optopthAbgetshAgetshAbfgetshAfgetshAbmallochAmallochA freehAbreallohAreallohAbcallochAcallochAbmemccphAmemccphAbmemchrhAmemchrhA$memcmphAmemcmphAbmemcpyhAmemcpyhAbmemsethAmemsethAhpopenhApopenhA$pclosehApclosehA$printfhAprintfhA$fprinthAfprinthA$sprinthAsprinthA$putchAputchA$putchahAputchahA$fputchAfputchA$putwhAputwhA$putshAputshA$fputshAfputshA qsorthA srandhA$randhArandhA$scanfhAscanfhA$fscanfhAfscanfhA$sscanfhAsscanfhA setbufhA$setjmphAsetjmphA longjmhA.sleephAsleephAdssignahAssignahA$gsignahAgsignahA8_iobhAbstrcathAstrcathAbstrncahAstrncahA$strcmphAstrcmphA$strncmhAstrncmhAbstrcpyhAstrcpyhAbstrncphAstrncphA$strlenhAstrlenhAbstrchrhAstrchrhAbstrrchhAstrrchhAbstrpbrhAstrpbrhA$strspnhAstrspnhA$strcsphAstrcsphAbstrtokhAstrtokhA'strtodRhAstrtodhA'atofhAatofhA%strtolRhAstrtolhA%atolhAatolhA$atoihAatoihA$systemhAsystemhAbtmpnamhAtmpnamhAbttynamhAttynamhA$isattyhAisattyhA$ungetchAungetchAhfdopenhAfdopenhAbtempnahAtempnahAhtmpfilhAtmpfilhA8_iobgeto k,++-\,  ./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/getpasswd.ou[+&E.textP .dataPP,&@.bss||U5US]hhp# }7hhhhPh@h=uhS5s=p$t5p$\p$*[fU5uÐU0SV] S/=u+^[u@PEPu 5hh|$ tuh|$Ph|$E t‹E0@PEPE0 E0MEPEP E0E^[+^[US]5S [fUSVu ]V1=u+^[f5hP tJPPPE tSEPP tE^[+^[ÐU=t5=p$t5p$`p$.IfUuhP' u+ÍPPP ÉT$:t:t  tB u  tBÐT$:t;t :tB:t :tBfT$:t;t /tBfU5USV]p# u5hhp#0 }hh@h =uhS u+^[Ã=p$tL545t$5p$$ 5p$ u+^[ VT u^[ÍPPPu tB}54  _V N^['5hP u+^[ÍPPP  u+^[fftfeV;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uaV_ 4 @uLV@ 4hp#hhP t PV 454@PA V w^[@uyhp#hhP/ t+^[ËPPPP tt @P Vq  ^[USVW} Efftf+!EV;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u1S( VW tE_^[+_^[Ë@@uNhp#WhPx t*S VW' tE_^[+_^[Ë@EV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ S V@PA tE_^[+_^[Ë@@u4hp#WhP9 E_^[Ë@EV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ E_^[ËEV׋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u _^[+_^[U SVW} EfftfV ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u0SVu* t _^[+_^[ËE@@udPPhSVu t+hp#3hP0 t _^[+_^[StV@P tC;Eu _^[+_^[ËE@@uZPPhtu7 tbhp#3hP tC_^[Ë@P2;Eu"_^[ËC;Eu _^[+_^[ÐUShtu tC[ø[U Sht$hp$EPEP5x$5h"hp# t p$=t5EEx$[fU Sht$hp$EPEPh0hp#x t p$=t5QEEx$[fUSVW] EPEPuPuh>hp# t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[ÐU$SVW] uhLEP[ EPEPEPGPEPhPhp#0 t+_^[uuu u+_^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$_^[fUSV]u ue u+^[Ã{tC8tCF{tC8tCF{ tC 8tC F {$tC$8tC$F$^[USVWu uh4 4E 4 E @4+4S؉4S:u u+_^[h EPS; ]C:t u+_^[ |  tǣ4:u u+_^[h EPS ]C:t u+_^[ |  tǣ44S؉4S؉4S4;t ,tC;tC4444S/u*ChEPS ;]u]=4S;u C44_^[ÉUS4 t3 S[ u4[ÐUSVhu@PuS4F54^[ÐUS]=DtNDp|DplDp \Dp$L5D>h(1DDEs@PMAsDpDEs@PMAsDpDEs @PMA s Dp DEs$w@PmMA$s$Dp$TD[ÐUSVE54 EVӋ;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u ^[Ëv ?+^[ÐUSVWu]E} tE  |$~+_^[E u@ A  uLE u"@ A t CEϋEtu ECE u+}0t Cxt CXuE u@ A  E u@ A  tEBE u@ A  t E E E;|+_^[ÃuJ}0uDC u4@ A% tCxt CXu EE u@ A  tEBE u@ A  t E E ؋ +ECE @ A E u@ A  tEBE u@ A  t E E E;?} tE }t_^[Ë_^[ÉU$Su u[EE E܉EfEEPSEuu +[USVWEh^h` u _^[É}WhhDr D5Ef:t t;tFC܋EEVЍ5E;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ EWl}u _^[ÍDEuLEu u +_^[ÐUSVu++ۃ fE Cà ~V u+^[É>t,f uFVE V +^[ÐD$Ésrc.com/lib/libc/Lgen/getpasswd.cpsetpwent: getdomainname system call missing system.catrgetpwent: getdomainname system call missing r+**++passwd.bynamepasswd.bynamepasswd.byname%dpasswd.byuidr/etc/sitegroup/etc/passwd?D"*.?=?B:K@P5]6f?n?t4|??&DD%D??>?D!7-D2;DTg>???7m?v?{8?DD%D<7?DD*?@56??4?D'D-D3DCDH%1D<?7Q? D(D-D2?B-^$tDzDD?-$1'<?sD- D - ?  D -= E ?[ Dn - ? D DD ??D+D5?>?C%N?VDhDmDz?DD??%?D?D%?!?D%DDD DD0DDDDD'D6D[DaDgDq?vDDDDD%% D#.0:.H RD[DpDxD%D%D%D%D%.DD.D D#.4D< DDOY.jDr zD.D DDBBABBA}BBABBABBAABMBTABBABBAB$B+ABBQBXAxBBA /4 Q?V?[4D7DDD8D=#=I?.fileggetpasswd.c.textP.dataP,.bss|setpwent!-;Xmatchuidh E`X uidof jpwskippwskip1@ttsaved~`strlenyp_nextypstrtolyp_firstyp_matchstrncpystrcpysprintfDfreerewindgetpwnamgetpwuidinnetgrmallocputpwentgetpwentgetpw @fopenfprintfexitfgetsfclose&endpwenth0atoi<%_DUMoZ0P_iob_MB_ctab__c_temp%_SUMoZ0p%_BUMoZ0p#Ffreeminuslistaddtominuslistonminuslistfillsitearraymatchnamegetfirstfromyellowgetnextfromyellowinterpretgecosskipgetnamefromyellowgetuidfromyellowinterpretwithsavesetpwfilersetpwentsetnetgrentrgetpwnamrgetpwuidrgetpwentgetdomainnamegetnetgrentget_access_sitesfgetpwentNLgetamsgendnetgrentNLflatstrro k r{++-{./usr/lpp/adst/inst_updt/lpp.archives/lib/libc.a/setlocale.ou+2tI.text,$_ .data,$,$4;$pU@.bss`_`_USVu] uVSh7Sh;Sh?ShCShGShKSƍ /PhKhGhCh?h;h7hSh+R u +^[Ëƍ /^[fUSVW]u |~+_^[VhO u&u +_^[ËÍ /_^[ uS _^[VT;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uSSg_^[CuRF@uGSSFPh thS S _^[DžGF  t"G@uGSVh9 PS% t+_^[S_^[ÐUHSVW] h u _^[ËE tD}tExuE@E}u担MH EHE$ȉH @@EЍEԉEE+ɈEǃt t4EEC  E@=uߋE@ u+8 u+- D I;;EMQvQSAh1Axu _^[Ë@H @EЍEԉEE+ɈECh u+8 u+- D I; +_^[fƃ ~EEЋC  uYEMQ%QA@D;uE+_^[@t _^[Ë_^[US] t+{t[;[ t[ s\SQ[fT$ t;D$uD$ Bà ƒ8u+fUS&fCMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u[à Ã84+[fT$+ t;D$uËA ƒ8uÉT$ t;D$uBà ƒ8u+fUSVW+ۋCM +4 Vh) |k f<)tk 4)ƃt tu-thT hT hT5k f)Vh(2PVh) G_^[ÉUSVW]} tFJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv  ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ uv ME܉MVЋE܋;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ u6v1 u56KEk f)Ek N )v  t26vv uup_^[u[+_^[ÐU SVW} t E  u+_^[hu PPPPmVT;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ th TPhTP u5PhThl&h@gh TZ_^[+ߐVhP6 tQ t#tЍP ƄEuPS V_^[ÉU SVW}Eh*TE tE8u 0TEWP|uhB u0WCPh( PhS=+_^[fEk &E 3uh&PE E8EMEMVЋE;tt ;upсက#uZFJ;uTсက#u>FJ;u8сက#u"F J ;uсက#t3":u"t:u"t:u"t:埘^ tBuu u0WCPh Ph<S+_^[ESW>_^[Wh&E u+_^[u t uh2T t uh8TWM_^[VW>_^[ÉUSVW]u }| t u+_^[Ã}fE\uFR:uJ u+8 u+- D I;uF5 u+# D + l u+_^[Ã}SfCF  ts\u CF :uJ u+8 u+- D I;uC_^[USVuu h) u+^[Ã}}SV^[uSVT u+^[Ë^[fU SVW+ۋfE+< t[Wh&\EWh)KE}t}uF